Quick Search

Enter gene name or accession number


Gene: MSMEG_4528

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_4528
Accession numberMSMEG_4528
TypeCDS
FunctionUNKNOWN
Productphosphoadenosine phosphosulfate reductase
Commentsidentified by match to protein family HMM PF01507; match to protein family HMM TIGR00434; match to protein family HMM TIGR02055
Molecular mass (Da)25691.9
Isoelectric point4.4663
Gene length (bp)711
Protein length236
Location (kb)4616.14


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS46161444616854+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_4528
MTDVTTSTENELRELAERGAAELADASAEELLRWTDEHFGGNYVVASNMQDAVLVEMAAKVRPGVDVLFLDTGYHFAETI
GTRDAVEAVYDVHVVNVTPERTVAEQDELLGKNLFARDPGECCRLRKVVPLTNALKGYSAWVTGIRRVEAPTRANAPLIS
WDNAFGLVKINPIAAWTDEDMQNYIDANGILVNPLVYEGYPSIGCAPCTSKPIPGADPRSGRWAGLSKTECGLHVS
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification1.8.4.8
Gene Ontologyphosphoadenylyl-sulfate reductase (thioredoxin) activity
transferase activity
cysteine biosynthetic process
sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
oxidation reduction
MtuberculosisRv2392
UniProtA0R0W2