Quick Search

Enter gene name or accession number


Gene: MSMEG_4529

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_4529
Accession numberMSMEG_4529
TypeCDS
FunctionUNKNOWN
Productsecreted protein
Commentsidentified by match to protein family HMM PF01903
Molecular mass (Da)25070.4
Isoelectric point6.7266
Gene length (bp)714
Protein length237
Location (kb)4616.85


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS46168514617564+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_4529
MTLVLTAHGSADPRSSANAHAIAGHVRRLLPDTEVRVAFCEQNEPNLADVLTAVEAGSVVVPLLLASAYHARIDIPALIA
QTGADVVQADVLGNDPRLLQVMRERLTALGVSRFDSSLGVVLTGVGSSHAAANARTAELAADLAEGTRWVGTHVAFATGQ
DPSVSRAVERLRARGATRLVIAPWFLAHGRITDRVAEYARREGIPMAEPLGPHRLVAATVLDRYEEAIEARTAGFAA
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologycobalamin biosynthetic process
lyase activity
metal ion binding
MtuberculosisRv2393
UniProtA0R0W3