Quick Search

Enter gene name or accession number


Gene: MSMEG_4530

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namecysA
Accession numberMSMEG_4530
TypeCDS
FunctionUNKNOWN
Productsulfate ABC transporter, ATP-binding protein
Commentsidentified by match to protein family HMM PF00005; match to protein family HMM PF03459; match to protein family HMM TIGR00968
Molecular mass (Da)38754.7
Isoelectric point6.0537
Gene length (bp)1086
Protein length361
Location (kb)4618.67


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS46175834618668-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | cysA
MSDTSTQTNTSAIVVRGANKHYGDFAALDNIDFEVPSGSLTALLGPSGSGKSTLLRAIAGLDQPDSGTVTINGRDVTGVP
PQQRGIGFVFQHYAAFKHLSVRDNVAFGLKIRKRPKAEIAERVDNLLEVVGLSGFQTRYPNQLSGGQRQRMALARALAVD
PQVLLLDEPFGALDAKVRDDLRTWLRRLHDEVHVTTVLVTHDQSEALDVADRIAVLNKGRIEQIGSPTEVYDQPANAFVM
SFLGAVSEINGILVRPHDIRVGRTPEMAIAASDGTAEATGVLRATIDRIVMLGFEVRVELTSAASHVPFTAQITRGDAEA
LGLEEGDTVYVRATRVPHIAGEAQVPRTATNNVNADAALAQ
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification3.6.3.25
Gene OntologyATP binding
sulfate transport
sulfate transmembrane-transporting ATPase activity
ATP-binding cassette (ABC) transporter complex
MtuberculosisRv2397c
UniProtA0R0W4