Quick Search

Enter gene name or accession number


Gene: MSMEG_4531

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namecysW
Accession numberMSMEG_4531
TypeCDS
FunctionUNKNOWN
Productsulfate ABC transporter, permease protein CysW
Commentsidentified by match to protein family HMM PF00528; match to protein family HMM TIGR00969; match to protein family HMM TIGR02140
Molecular mass (Da)29294.8
Isoelectric point10.4289
Gene length (bp)825
Protein length274
Location (kb)4619.51


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS46186844619508-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | cysW
MTLSPVVRRLLRFTALAYILVLVVVPVGLILWRTFAPGIGAFVTSISTPAAISALNLSLLVVAIVVPLNVLFGVPTALVL
ARNKFRGKSALQAVIDLPFAVSPVVVGVALILLWGSAGLFGFVENNLGLKIIFGFPGIVLASIFVTVPFVIREVEPVLHE
IGTDQEEAAATLGSTWWQTFWRITLPSIRWGLTYGIVLTIARTLGEFGAVIMVSSNLPGVSQTLTLLVADRYNRGTADSV
YGAYAISTLLMAVAVVVLVAQVLLDKRRAKAEQS
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologyplasma membrane
sulfate transport
sulfate transmembrane transporter activity
uptake transmembrane transporter activity
integral to membrane
MtuberculosisRv2398c
UniProtA0R0W5