Quick Search

Enter gene name or accession number


Gene: MSMEG_4532

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namecysT
Accession numberMSMEG_4532
TypeCDS
FunctionUNKNOWN
Productsulfate ABC transporter, permease protein CysT
Commentsidentified by match to protein family HMM PF00528; match to protein family HMM TIGR00969; match to protein family HMM TIGR02139
Molecular mass (Da)29734.7
Isoelectric point7.7001
Gene length (bp)858
Protein length285
Location (kb)4620.36


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS46195054620362-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | cysT
MTAPAEASTAAPGAPAPRAARGRYGSTSLRVGAASIWLSVIVLLPLAAILWQAAGGGWDAFWRAVTSNAAVDSFQVTLTI
SAGVTVVNAVFGLLVAWVLTRDEFPGKRIVDSVIDLPFALPTIVASLVMLALYGPASPVDLHLQHTKWGVGIALLFVTLP
FVVRSVQPVLLELDREVEEAAASLGAGNRTIFLRVILPALLPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWI
RTLIENDDRTGAAAISIVLLVISFAVLFVLRAVGARAAKREELEG
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologysulfate transport
sulfate transmembrane transporter activity
uptake transmembrane transporter activity
integral to membrane
MtuberculosisRv2399c
UniProtA0R0W6