Quick Search

Enter gene name or accession number


Gene: MSMEG_4989

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_4989
Accession numberMSMEG_4989
TypeCDS
FunctionUNKNOWN
Productsensor histidine kinase
Commentsidentified by match to protein family HMM PF00512; match to protein family HMM PF00672; match to protein family HMM PF02518
Molecular mass (Da)56287.2
Isoelectric point6.6377
Gene length (bp)1584
Protein length527
Location (kb)5087.41


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS50858285087411-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_4989
MFFVPRADAPRAAVGGTRWWSPRTWPLRARLVGTQVALLAVVCLSIGLATEFALQRFLMHQLDEQLLEAGRRSAAIYELP
PPPRGFLPLFPPGMGPPGRHLRVFDPEQGPGPGFLNAPGQAARTVGAVVSPDGSVDAGVITSDGDRQEVSAAAARQLAAI
PATREPQTIDLDGLGRYRLIGLHPRHGGPQTIVTGLPNSVVDDTLLWVLGMFCVIAAVALIAAITAGTLLIRRQFAPLAR
VSATAREVADLELERGEVRLPTPIVPVDPAVAHTEVGQLGTSLNRMLDRIASALSARHASETRVRQFVADASHELRTPLA
AIRGYTELAQRKRGELPDDVAHAMSRVESETSRMTQLVEDMLLLARLDAGRPLERDRVELSRLVVDTVSDAHVAGPQHKW
SLDLPEDAVVIDGDEARLHQVMANLLANARTHTPPGTSVTVALSADAEGWVTVAVTDDGPGIAPELLPDVFERFARGDSS
RSRREGSTGLGLAIVAAVVKAHGGVIDVTSRPGETRFVVRLPGAAHS
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
signal transduction
integral to membrane
peptidyl-histidine phosphorylation
MtuberculosisRv3764c
UniProtA0R252