Quick Search

Enter gene name or accession number


Gene: MSMEG_4990

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_4990
Accession numberMSMEG_4990
TypeCDS
FunctionUNKNOWN
ProductDNA-binding response regulator
Commentsidentified by match to protein family HMM PF00072; match to protein family HMM PF00486
Molecular mass (Da)27256.3
Isoelectric point4.927
Gene length (bp)750
Protein length249
Location (kb)5088.14


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS50873895088138-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_4990
MGTANGTEIETGRAVMRRADGNPIRVLVVDDEPVLAELVSMALRYEGWDITTAGDGASAIAAARETPPDVVVLDVMLPDM
SGLDVLRKLREQIPGLPLLLLTAKDSVEDRIAGLTAGGDDYVTKPFSLEEVVLRLRALLRRTGVTSEDGGAKIVVGDLVL
DEDSHEVTRGGDPIALTATEFELLRFMMRNAKRVLSKAQILDRVWSYDFGGRSNIVELYVSYLRKKIDSGREPMIHTLRG
AGYVLRPPR
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
regulation of transcription, DNA-dependent
MtuberculosisRv3765c
UniProtA0R253