Quick Search

Enter gene name or accession number


Gene: MSMEG_5265

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_5265
Accession numberMSMEG_5265
TypeCDS
FunctionUNKNOWN
Productputative cystathionine gamma-synthase
Commentsidentified by match to protein family HMM PF01041; match to protein family HMM PF01053; match to protein family HMM PF01212
Molecular mass (Da)40457.6
Isoelectric point5.6753
Gene length (bp)1155
Protein length384
Location (kb)5357.48


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS53563235357477-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_5265
MSEHRKWHGLATKAIHAGYQPDPATGAVNTPIYASSTFAQDGVGGLRGGFEYARTGNPTRQSLEAALAAVEEARFGRAFS
SGMAATDCALRAVLRPGDHVVIPDDAYGGTFRLIDKVFTHWGISHTPAALSDLDSVRSAITPKTRLIWVETPTNPLLNVA
DIAGIVQIASSTGVKVLVDNTFASPALQQPLLLGADIVLHSTTKYIGGHSDVVGGALLTNDEELDAAFAFLQNGAGGVPG
PFDAYLTMRGLKTLVLRMRQHSENAALIAEFLDGHPAVQTVLYPGLPSHPNHDVAARQMTGFGGMVSVRLRGGPQAARDL
CSRTEIFILAESLGGVESLIEYPGAMTHASTAGSQLEVPDDLVRLSVGIEHSADLLADLEQALG
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification2.5.1.48
Gene Ontologycystathionine gamma-synthase activity
cellular amino acid metabolic process
pyridoxal phosphate binding
MtuberculosisRv1079
UniProtA0R2X3