Quick Search

Enter gene name or accession number


Gene: MSMEG_5395

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_5395
Accession numberMSMEG_5395
TypeCDS
FunctionUNKNOWN
Productsensor protein KdpD
Commentsidentified by match to protein family HMM PF00512; match to protein family HMM PF00582; match to protein family HMM PF02518; match to protein family HMM PF02702
Molecular mass (Da)89055.4
Isoelectric point5.8169
Gene length (bp)2520
Protein length839
Location (kb)5473.21


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS54732065475725+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_5395
MTTRASNASKRGELRIYLGAAPGVGKTYAMLGEAHRRLDRGTDLVAAVVETHGRKNTAELLAGIEVIPPRYIEYRGGRFP
ELDVPAVLDRKPQVVLVDELAHTNTPGSKNAKRWQDVDELLNAGITVISTVNVQHLDSLNDVVAAITGIEQQETVPDEVV
RSADQIELVDITPEALRRRLSHGNVYAPERIDAALSNYFRRGNLTALRELALLWLADQVDAALAKYRADNKITALWETRE
RVVVAVTGGTESETLVRRAFRIASKSSAELMVVHVVHGDGLTGISAAQMGKVRELAVSLGATVHTVVGDDVPTALLDFAR
DINATQLVLGTSRRSRWARMFDEGIGATVVQQSQKIDVHMVTHEAAKRGFRWSSTSPRQRHAASWAAALMVPSLICAFSV
AILDPFLDVGGKSALFFVGVLVVALLGGVAPAALSAVLSGLLLNYFLTSPRHTFTMSDPDSALTIVVLLAVAVAVAALVD
GAAKRAREARHASREAELLALFAGSVLRGADLTALLERVRETYAQRAVSLLRETSDGATIVDCVGQDPCDRVAAADTAVE
AGDEFWLLLSGRELPARDRRVLGAVANQAAGLVRQRELTEEAAKANAIAKADELSRSLLSAVSHDLRTPLAAAKAAASSL
RSCDIDFSAEDTAELLATIEESVDALTALVGNLLDSSRLAAGVIHPELRPVYLEETVQRALLGIRRGPTGYGRSAVDRVK
VEVGDSVALADGGLLERVLANLIDNALRYAPDGLIRVTAGRVANKVLIAVVDEGPGIPRGAEDALFAPFQRLGDTNTTTG
VGLGLSVAKGFVEAMGGTISAGDTPGGGLTVEIELAVPA
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
response to stress
signal transduction
membrane
peptidyl-histidine phosphorylation
MtuberculosisRv1028c
UniProtA0R398