Quick Search

Enter gene name or accession number


Gene: MSMEG_5396

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_5396
Accession numberMSMEG_5396
TypeCDS
FunctionUNKNOWN
ProductKDP operon transcriptional regulatory protein KdpE
Commentsidentified by match to protein family HMM PF00072; match to protein family HMM PF00486
Molecular mass (Da)25428.1
Isoelectric point5.91
Gene length (bp)693
Protein length230
Location (kb)5475.72


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS54757225476414+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_5396
MTAPIKTRVLVIDDEPQILRALRINLSVRGYEVRTAASGAEALHSAADHRPDVIVLDLGLPDMSGIEVLHGLRGWLSAPV
IVLSARTDSSDKVEALDAGADDYVTKPFGMDEFLARLRAAARRAAVPETDQPVIETTSFTVDLAAKKVIKNGAEVHLTPT
EWGMLEMLVRNRGKLVGREELLREVWGPAYATETHYLRVYLAQLRRKLEDDPSHPVHLLTEAGMGYRFEA
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
transcription
regulation of transcription, DNA-dependent
MtuberculosisRv1027c
UniProtA0R399