Quick Search

Enter gene name or accession number


Gene: MSMEG_5513

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_5513
Accession numberMSMEG_5513
TypeCDS
FunctionUNKNOWN
Productserine/threonine-protein kinase PknE
Commentsidentified by match to protein family HMM PF00069
Molecular mass (Da)65527
Isoelectric point6.3119
Gene length (bp)1857
Protein length618
Location (kb)5600.14


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS56001425601998+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_5513
MPLASGQVFAGFTIVRLVGTGGMGEVYLAKHPRLPREDALKVLPISVSADDEFRQRFIREADMAATLWHPHIVGVHDRGE
FEGRLWISMDYVDGHDAARLLHDKYPKGMPADDVVEIVTAVGDALDYAHQRQLLHRDVKPANILVTEKHGTKRRIMLTDF
GIARRTDDVNGLTSTNITVGSMSYTSPEQLMGQPLDGRADQYSLAATAYRLLTGAPPFSHSNPAVVISHHLNSPPPKLGD
TKPALAKLDSVMAKALAKDAKDRFDTCHDFAVALAEANKGDESAAPVTAAPPPVITPPVQTAPPTTPLKAQTLPAPPTPP
TPLSPSNPQAPTASQPPVFTSSWAGHDDPSGRQPVAVPAPAPPPPPPPSNFGPPPPAYSPPPRKSGGDRRKLIIAAAAIG
AVVLLVGGITLAVTSGGDNDSAGAAATTSETASETPVTTTPKKPGEHAYTIADYIRDNKISETPVHRGDPNTPELTMPTP
PGWADAGTRTPAWAYSAIVNDPASPTDPPSVISLISKLDGNVDPEKLLEFAPNELQNLTEWEPIGGVTRSNLSGFPSVQL
GGSYLKDGKRRAITQKTVVVDIPSGIYVLQINADSLYRDFGALVDVNKAIDKEATIKP
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification2.7.11.1
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
MtuberculosisRv1266c
UniProtA0R3L2