BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0031 Length=70 Score E Sequences producing significant alignments: (Bits) Value gi|15607173|ref|NP_214545.1| remnant of A transposase [Mycobacte... 141 4e-32 gi|289751449|ref|ZP_06510827.1| transposase [Mycobacterium tuber... 56.2 2e-06 gi|339295640|gb|AEJ47751.1| putative transposase [Mycobacterium ... 54.7 4e-06 gi|289758918|ref|ZP_06518296.1| predicted protein [Mycobacterium... 54.7 4e-06 gi|340625715|ref|YP_004744167.1| putative transposase [Mycobacte... 54.7 5e-06 gi|289448449|ref|ZP_06438193.1| transposase [Mycobacterium tuber... 54.7 5e-06 gi|148823979|ref|YP_001288733.1| transposase [Mycobacterium tube... 54.7 5e-06 gi|15609928|ref|NP_217307.1| transposase [Mycobacterium tubercul... 54.7 5e-06 gi|15842329|ref|NP_337366.1| IS1602 transposase [Mycobacterium t... 54.7 5e-06 gi|289746594|ref|ZP_06505972.1| transposase [Mycobacterium tuber... 54.3 5e-06 gi|340627967|ref|YP_004746419.1| putative transposase [Mycobacte... 54.3 6e-06 gi|289575685|ref|ZP_06455912.1| transposase [Mycobacterium tuber... 54.3 6e-06 gi|339299426|gb|AEJ51536.1| transposase [Mycobacterium tuberculo... 54.3 6e-06 gi|15610115|ref|NP_217494.1| transposase [Mycobacterium tubercul... 54.3 6e-06 gi|339632984|ref|YP_004724626.1| transposase [Mycobacterium afri... 54.3 7e-06 gi|15610963|ref|NP_218344.1| transposase [Mycobacterium tubercul... 53.1 1e-05 gi|167969942|ref|ZP_02552219.1| IS1537 transposase [Mycobacteriu... 53.1 1e-05 gi|15843451|ref|NP_338488.1| IS1537 transposase [Mycobacterium t... 53.1 1e-05 gi|148825034|ref|YP_001289788.1| transposase [Mycobacterium tube... 52.8 2e-05 gi|289441265|ref|ZP_06431009.1| transposase [Mycobacterium tuber... 52.8 2e-05 gi|340628796|ref|YP_004747248.1| putative transposase [Mycobacte... 52.8 2e-05 gi|289446159|ref|ZP_06435903.1| transposase [Mycobacterium tuber... 51.6 3e-05 gi|15607746|ref|NP_215120.1| hypothetical protein Rv0606 [Mycoba... 51.6 4e-05 gi|50953767|ref|YP_061206.1| truncated IS1536 transposase [Mycob... 51.6 4e-05 gi|294994021|ref|ZP_06799712.1| transposase [Mycobacterium tuber... 44.7 0.005 gi|289444440|ref|ZP_06434184.1| transposase [Mycobacterium tuber... 44.3 0.005 gi|308374721|ref|ZP_07437115.2| transposase [Mycobacterium tuber... 44.3 0.005 gi|31794061|ref|NP_856554.1| putative transposase [Mycobacterium... 44.3 0.006 gi|289759006|ref|ZP_06518384.1| conserved hypothetical protein [... 44.3 0.006 gi|339295723|gb|AEJ47834.1| hypothetical protein CCDC5079_2644 [... 44.3 0.006 gi|167969513|ref|ZP_02551790.1| transposase [Mycobacterium tuber... 44.3 0.006 gi|289553326|ref|ZP_06442536.1| transposase [Mycobacterium tuber... 44.3 0.006 gi|15610022|ref|NP_217401.1| transposase [Mycobacterium tubercul... 44.3 0.006 gi|308373566|ref|ZP_07432874.2| transposase [Mycobacterium tuber... 44.3 0.006 >gi|15607173|ref|NP_214545.1| remnant of A transposase [Mycobacterium tuberculosis H37Rv] gi|15839407|ref|NP_334444.1| hypothetical protein MT0035 [Mycobacterium tuberculosis CDC1551] gi|31791208|ref|NP_853701.1| putative remnant of a transposase [Mycobacterium bovis AF2122/97] 32 more sequence titles Length=70 Score = 141 bits (355), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%) Query 1 LLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRV 60 +LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRV Sbjct 1 MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRV 60 Query 61 GPGASEAPLA 70 GPGASEAPLA Sbjct 61 GPGASEAPLA 70 >gi|289751449|ref|ZP_06510827.1| transposase [Mycobacterium tuberculosis T92] gi|289692036|gb|EFD59465.1| transposase [Mycobacterium tuberculosis T92] Length=113 Score = 56.2 bits (134), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|339295640|gb|AEJ47751.1| putative transposase [Mycobacterium tuberculosis CCDC5079] Length=274 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|289758918|ref|ZP_06518296.1| predicted protein [Mycobacterium tuberculosis T85] gi|289714482|gb|EFD78494.1| predicted protein [Mycobacterium tuberculosis T85] Length=303 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 58 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 93 >gi|340625715|ref|YP_004744167.1| putative transposase [Mycobacterium canettii CIPT 140010059] gi|340003905|emb|CCC43037.1| putative transposase [Mycobacterium canettii CIPT 140010059] Length=459 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|289448449|ref|ZP_06438193.1| transposase [Mycobacterium tuberculosis CPHL_A] gi|289421407|gb|EFD18608.1| transposase [Mycobacterium tuberculosis CPHL_A] Length=459 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|148823979|ref|YP_001288733.1| transposase [Mycobacterium tuberculosis F11] gi|253798125|ref|YP_003031126.1| transposase [Mycobacterium tuberculosis KZN 1435] gi|289553422|ref|ZP_06442632.1| transposase [Mycobacterium tuberculosis KZN 605] 10 more sequence titles Length=459 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|15609928|ref|NP_217307.1| transposase [Mycobacterium tuberculosis H37Rv] gi|31793967|ref|NP_856460.1| transposase [Mycobacterium bovis AF2122/97] gi|121638671|ref|YP_978895.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] 53 more sequence titles Length=459 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|15842329|ref|NP_337366.1| IS1602 transposase [Mycobacterium tuberculosis CDC1551] gi|13882625|gb|AAK47180.1| IS1602, transposase [Mycobacterium tuberculosis CDC1551] Length=459 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|289746594|ref|ZP_06505972.1| transposase [Mycobacterium tuberculosis 02_1987] gi|289687122|gb|EFD54610.1| transposase [Mycobacterium tuberculosis 02_1987] Length=459 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADI AW GIQT KP Sbjct 29 LARHFGARRKAYNWTVATLKADIDAWQATGIQTAKP 64 >gi|340627967|ref|YP_004746419.1| putative transposase [Mycobacterium canettii CIPT 140010059] gi|340006157|emb|CCC45331.1| putative transposase [Mycobacterium canettii CIPT 140010059] Length=459 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADIQAWH +G T KP Sbjct 29 LARHFGARRKAYNWTVATLKADIQAWHASGTVTAKP 64 >gi|289575685|ref|ZP_06455912.1| transposase [Mycobacterium tuberculosis K85] gi|289540116|gb|EFD44694.1| transposase [Mycobacterium tuberculosis K85] Length=459 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADIQAWH +G T KP Sbjct 29 LARHFGARRKAYNWTVATLKADIQAWHASGTVTAKP 64 >gi|339299426|gb|AEJ51536.1| transposase [Mycobacterium tuberculosis CCDC5180] Length=459 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADIQAWH +G T KP Sbjct 29 LARHFGARRKAYNWTVATLKADIQAWHASGTVTAKP 64 >gi|15610115|ref|NP_217494.1| transposase [Mycobacterium tuberculosis H37Rv] gi|15842532|ref|NP_337569.1| IS1538 transposase [Mycobacterium tuberculosis CDC1551] gi|31794154|ref|NP_856647.1| resolvase [Mycobacterium bovis AF2122/97] 70 more sequence titles Length=459 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADIQAWH +G T KP Sbjct 29 LARHFGARRKAYNWTVATLKADIQAWHASGTVTAKP 64 >gi|339632984|ref|YP_004724626.1| transposase [Mycobacterium africanum GM041182] gi|339332340|emb|CCC28053.1| putative transposase [Mycobacterium africanum GM041182] Length=459 Score = 54.3 bits (129), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VATLKADIQAWH +G T KP Sbjct 29 LARHFGARRKAYNWTVATLKADIQAWHASGTVTAKP 64 >gi|15610963|ref|NP_218344.1| transposase [Mycobacterium tuberculosis H37Rv] gi|148663695|ref|YP_001285218.1| IS1537 transposase [Mycobacterium tuberculosis H37Ra] gi|2224818|emb|CAB10011.1| POSSIBLE TRANSPOSASE [Mycobacterium tuberculosis H37Rv] gi|148507847|gb|ABQ75656.1| IS1537 transposase [Mycobacterium tuberculosis H37Ra] Length=408 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ AVATLKADI+AW GI T KP Sbjct 30 LARHFGARRKAYNWAVATLKADIEAWRVTGIGTVKP 65 >gi|167969942|ref|ZP_02552219.1| IS1537 transposase [Mycobacterium tuberculosis H37Ra] gi|308232584|ref|ZP_07416527.2| transposase [Mycobacterium tuberculosis SUMu001] gi|308379635|ref|ZP_07486968.2| transposase [Mycobacterium tuberculosis SUMu010] 6 more sequence titles Length=407 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ AVATLKADI+AW GI T KP Sbjct 29 LARHFGARRKAYNWAVATLKADIEAWRVTGIGTVKP 64 >gi|15843451|ref|NP_338488.1| IS1537 transposase [Mycobacterium tuberculosis CDC1551] gi|31795001|ref|NP_857494.1| putative transposase [Mycobacterium bovis AF2122/97] gi|121639745|ref|YP_979969.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] 30 more sequence titles Length=408 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ AVATLKADI+AW GI T KP Sbjct 30 LARHFGARRKAYNWAVATLKADIEAWRVTGIGTVKP 65 >gi|148825034|ref|YP_001289788.1| transposase [Mycobacterium tuberculosis F11] gi|254233316|ref|ZP_04926642.1| hypothetical protein TBCG_03753 [Mycobacterium tuberculosis C] gi|254366371|ref|ZP_04982415.1| transposase [Mycobacterium tuberculosis str. Haarlem] 26 more sequence titles Length=407 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ AVATLKADI+AW GI T KP Sbjct 29 LARHFGARRKAYNWAVATLKADIEAWRVTGIGTVKP 64 >gi|289441265|ref|ZP_06431009.1| transposase [Mycobacterium tuberculosis T46] gi|289572081|ref|ZP_06452308.1| transposase [Mycobacterium tuberculosis T17] gi|289748358|ref|ZP_06507736.1| transposase [Mycobacterium tuberculosis T92] gi|289414184|gb|EFD11424.1| transposase [Mycobacterium tuberculosis T46] gi|289545835|gb|EFD49483.1| transposase [Mycobacterium tuberculosis T17] gi|289688945|gb|EFD56374.1| transposase [Mycobacterium tuberculosis T92] Length=408 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ AVATLKADI+AW GI T KP Sbjct 30 LARHFGARRKAYNWAVATLKADIEAWRVTGIGTVKP 65 >gi|340628796|ref|YP_004747248.1| putative transposase [Mycobacterium canettii CIPT 140010059] gi|340006986|emb|CCC46177.1| putative transposase [Mycobacterium canettii CIPT 140010059] Length=459 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/36 (73%), Positives = 29/36 (81%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ AVATLKADI+AW GI T KP Sbjct 29 LARHFGARRKAYNWAVATLKADIEAWRVTGIGTVKP 64 >gi|289446159|ref|ZP_06435903.1| transposase [Mycobacterium tuberculosis CPHL_A] gi|289419117|gb|EFD16318.1| transposase [Mycobacterium tuberculosis CPHL_A] Length=216 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 25/36 (70%), Positives = 27/36 (75%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VA LKADIQAW G QT KP Sbjct 29 LARHFGARRKAYNWTVAQLKADIQAWRATGAQTAKP 64 >gi|15607746|ref|NP_215120.1| hypothetical protein Rv0606 [Mycobacterium tuberculosis H37Rv] gi|31791788|ref|NP_854281.1| transposase [Mycobacterium bovis AF2122/97] gi|121636524|ref|YP_976747.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] 49 more sequence titles Length=247 Score = 51.6 bits (122), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/36 (70%), Positives = 27/36 (75%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VA LKADIQAW G QT KP Sbjct 29 LARHFGARRKAYNWTVAQLKADIQAWRATGAQTAKP 64 >gi|50953767|ref|YP_061206.1| truncated IS1536 transposase [Mycobacterium tuberculosis CDC1551] gi|308231598|ref|ZP_07663888.1| transposase [Mycobacterium tuberculosis SUMu001] gi|308369994|ref|ZP_07666839.1| transposase [Mycobacterium tuberculosis SUMu002] 22 more sequence titles Length=273 Score = 51.6 bits (122), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/36 (70%), Positives = 27/36 (75%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA++ VA LKADIQAW G QT KP Sbjct 55 LARHFGARRKAYNWTVAQLKADIQAWRATGAQTAKP 90 >gi|294994021|ref|ZP_06799712.1| transposase [Mycobacterium tuberculosis 210] Length=386 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 18 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 53 >gi|289444440|ref|ZP_06434184.1| transposase [Mycobacterium tuberculosis T46] gi|289571075|ref|ZP_06451302.1| transposase [Mycobacterium tuberculosis T17] gi|289751550|ref|ZP_06510928.1| transposase [Mycobacterium tuberculosis T92] gi|289417359|gb|EFD14599.1| transposase [Mycobacterium tuberculosis T46] gi|289544829|gb|EFD48477.1| transposase [Mycobacterium tuberculosis T17] gi|289692137|gb|EFD59566.1| transposase [Mycobacterium tuberculosis T92] Length=439 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 30 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 65 >gi|308374721|ref|ZP_07437115.2| transposase [Mycobacterium tuberculosis SUMu006] gi|308340931|gb|EFP29782.1| transposase [Mycobacterium tuberculosis SUMu006] Length=446 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 29 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 64 >gi|31794061|ref|NP_856554.1| putative transposase [Mycobacterium bovis AF2122/97] gi|121638766|ref|YP_978990.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224991258|ref|YP_002645947.1| putative transposase [Mycobacterium bovis BCG str. Tokyo 172] 10 more sequence titles Length=439 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 30 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 65 >gi|289759006|ref|ZP_06518384.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|298526354|ref|ZP_07013763.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|289714570|gb|EFD78582.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|298496148|gb|EFI31442.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] Length=439 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 30 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 65 >gi|339295723|gb|AEJ47834.1| hypothetical protein CCDC5079_2644 [Mycobacterium tuberculosis CCDC5079] gi|339299339|gb|AEJ51449.1| hypothetical protein CCDC5180_2612 [Mycobacterium tuberculosis CCDC5180] Length=427 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 18 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 53 >gi|167969513|ref|ZP_02551790.1| transposase [Mycobacterium tuberculosis H37Ra] gi|254551956|ref|ZP_05142403.1| transposase [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] Length=448 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 18 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 53 >gi|289553326|ref|ZP_06442536.1| transposase [Mycobacterium tuberculosis KZN 605] gi|297635502|ref|ZP_06953282.1| transposase [Mycobacterium tuberculosis KZN 4207] gi|297732501|ref|ZP_06961619.1| transposase [Mycobacterium tuberculosis KZN R506] 6 more sequence titles Length=459 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 29 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 64 >gi|15610022|ref|NP_217401.1| transposase [Mycobacterium tuberculosis H37Rv] gi|15842427|ref|NP_337464.1| IS1539 transposase [Mycobacterium tuberculosis CDC1551] gi|148662729|ref|YP_001284252.1| IS1539 transposase [Mycobacterium tuberculosis H37Ra] 33 more sequence titles Length=460 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 30 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 65 >gi|308373566|ref|ZP_07432874.2| transposase [Mycobacterium tuberculosis SUMu005] gi|308337164|gb|EFP26015.1| transposase [Mycobacterium tuberculosis SUMu005] Length=454 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/36 (59%), Positives = 25/36 (70%), Gaps = 0/36 (0%) Query 2 LARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKP 37 LARHFGA RKA + V LKADI+AW G ++ KP Sbjct 24 LARHFGARRKAFNWTVTALKADIKAWRADGTESAKP 59 Lambda K H 0.318 0.130 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128245544896 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40