BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0105c Length=94 Score E Sequences producing significant alignments: (Bits) Value gi|15839485|ref|NP_334522.1| 50S ribosomal protein L28 [Mycobact... 187 4e-46 gi|340625141|ref|YP_004743593.1| putative 50S ribosomal protein ... 186 1e-45 gi|323717276|gb|EGB26483.1| 50S ribosomal protein L28 rpmB1 [Myc... 152 2e-35 gi|118464773|ref|YP_883997.1| ribosomal protein L28 [Mycobacteri... 105 3e-21 gi|254777316|ref|ZP_05218832.1| ribosomal protein L28 [Mycobacte... 105 3e-21 gi|118471258|ref|YP_890290.1| ribosomal protein L28 [Mycobacteri... 104 5e-21 gi|169627438|ref|YP_001701087.1| 50S ribosomal protein L28-2 [My... 101 3e-20 gi|342859239|ref|ZP_08715893.1| ribosomal protein L28 [Mycobacte... 101 4e-20 gi|54026949|ref|YP_121191.1| 50S ribosomal protein L28 [Nocardia... 100 8e-20 gi|111022583|ref|YP_705555.1| 50S ribosomal protein L28 [Rhodoco... 99.4 2e-19 gi|319950952|ref|ZP_08024824.1| 50S ribosomal protein L28 [Dietz... 98.6 3e-19 gi|120406435|ref|YP_956264.1| 50S ribosomal protein L28 [Mycobac... 98.2 3e-19 gi|226365090|ref|YP_002782873.1| 50S ribosomal protein L28 [Rhod... 98.2 4e-19 gi|118619876|ref|YP_908208.1| 50S ribosomal protein L28 RpmB2 [M... 97.1 8e-19 gi|334563965|ref|ZP_08516956.1| 50S ribosomal protein L28 [Coryn... 97.1 8e-19 gi|254818909|ref|ZP_05223910.1| 50S ribosomal protein L28 [Mycob... 97.1 9e-19 gi|325676326|ref|ZP_08156005.1| 50S ribosomal protein L28 [Rhodo... 96.7 1e-18 gi|227487783|ref|ZP_03918099.1| 50S ribosomal protein L28 [Coryn... 96.3 1e-18 gi|229495046|ref|ZP_04388792.1| ribosomal protein L28 [Rhodococc... 95.9 2e-18 gi|226307890|ref|YP_002767850.1| 50S ribosomal protein L28 [Rhod... 95.5 2e-18 gi|340795037|ref|YP_004760500.1| 50S ribosomal protein L28 [Cory... 95.1 3e-18 gi|38233448|ref|NP_939215.1| 50S ribosomal protein L28 [Coryneba... 94.4 6e-18 gi|305681979|ref|ZP_07404783.1| 50S ribosomal protein L28 [Coryn... 94.0 6e-18 gi|300858075|ref|YP_003783058.1| 50S ribosomal protein L28 [Cory... 94.0 6e-18 gi|68536621|ref|YP_251326.1| 50S ribosomal protein L28 [Coryneba... 94.0 7e-18 gi|262201431|ref|YP_003272639.1| 50S ribosomal protein L28 [Gord... 94.0 7e-18 gi|145221904|ref|YP_001132582.1| ribosomal protein L28 [Mycobact... 94.0 7e-18 gi|317506812|ref|ZP_07964586.1| ribosomal protein L28 [Segnilipa... 93.6 8e-18 gi|296118268|ref|ZP_06836849.1| ribosomal protein L28 [Corynebac... 93.6 9e-18 gi|336326218|ref|YP_004606184.1| 50S ribosomal protein L28 [Cory... 93.2 1e-17 gi|227504195|ref|ZP_03934244.1| 50S ribosomal protein L28 [Coryn... 92.8 1e-17 gi|343928748|ref|ZP_08768193.1| 50S ribosomal protein L28 [Gordo... 92.8 2e-17 gi|19552095|ref|NP_600097.1| 50S ribosomal protein L28 [Coryneba... 92.4 2e-17 gi|296393677|ref|YP_003658561.1| 50S ribosomal protein L28 [Segn... 92.4 2e-17 gi|227501466|ref|ZP_03931515.1| 50S ribosomal protein L28 [Coryn... 92.0 3e-17 gi|227832650|ref|YP_002834357.1| 50S ribosomal protein L28 [Cory... 91.3 4e-17 gi|237785096|ref|YP_002905801.1| 50S ribosomal protein L28 [Cory... 90.9 6e-17 gi|172040222|ref|YP_001799936.1| 50S ribosomal protein L28 [Cory... 90.5 7e-17 gi|326383108|ref|ZP_08204797.1| ribosomal protein L28 [Gordonia ... 90.5 7e-17 gi|25027499|ref|NP_737553.1| 50S ribosomal protein L28 [Coryneba... 88.2 4e-16 gi|108801694|ref|YP_641891.1| 50S ribosomal protein L28 [Mycobac... 87.8 4e-16 gi|302527617|ref|ZP_07279959.1| ribosomal protein L28 [Streptomy... 86.3 1e-15 gi|296140972|ref|YP_003648215.1| 50S ribosomal protein L28 [Tsuk... 85.9 2e-15 gi|258653985|ref|YP_003203141.1| 50S ribosomal protein L28 [Naka... 85.1 3e-15 gi|312138607|ref|YP_004005943.1| 50S ribosomal protein l28 rpmb ... 85.1 3e-15 gi|134097360|ref|YP_001103021.1| 50S ribosomal protein L28 [Sacc... 84.7 4e-15 gi|323358133|ref|YP_004224529.1| ribosomal protein L28 [Microbac... 84.0 6e-15 gi|213966101|ref|ZP_03394289.1| conserved domain protein [Coryne... 84.0 7e-15 gi|295394905|ref|ZP_06805118.1| 50S ribosomal protein L28 [Brevi... 84.0 7e-15 gi|50955925|ref|YP_063213.1| 50S ribosomal protein L28 [Leifsoni... 84.0 8e-15 >gi|15839485|ref|NP_334522.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CDC1551] gi|31791283|ref|NP_853776.1| 50S ribosomal protein L28 [Mycobacterium bovis AF2122/97] gi|57116690|ref|YP_177691.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Rv] 77 more sequence titles Length=94 Score = 187 bits (476), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 94/94 (100%), Positives = 94/94 (100%), Gaps = 0/94 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID Sbjct 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 Query 61 RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL 94 RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL Sbjct 61 RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL 94 >gi|340625141|ref|YP_004743593.1| putative 50S ribosomal protein L28-1 RPMB1 [Mycobacterium canettii CIPT 140010059] gi|340003331|emb|CCC42449.1| putative 50S ribosomal protein L28-1 RPMB1 [Mycobacterium canettii CIPT 140010059] Length=94 Score = 186 bits (472), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 93/94 (99%), Positives = 94/94 (100%), Gaps = 0/94 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRI+VRVSAQGIKVID Sbjct 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIRVRVSAQGIKVID 60 Query 61 RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL 94 RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL Sbjct 61 RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL 94 >gi|323717276|gb|EGB26483.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis CDC1551A] Length=77 Score = 152 bits (383), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%) Query 18 VSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDGHRGRRRAARAGSAP 77 +SHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDGHRGRRRAARAGSAP Sbjct 1 MSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDGHRGRRRAARAGSAP 60 Query 78 AHFARQAGSSLRTAAIL 94 AHFARQAGSSLRTAAIL Sbjct 61 AHFARQAGSSLRTAAIL 77 >gi|118464773|ref|YP_883997.1| ribosomal protein L28 [Mycobacterium avium 104] gi|118166060|gb|ABK66957.1| ribosomal protein L28 [Mycobacterium avium 104] Length=78 Score = 105 bits (261), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 50/63 (80%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FG AVSHSHRRT RRW PNIQLK YYLPSE RRI++RVSA+GIKVID Sbjct 1 MSADCQVTGRRPSFGNAVSHSHRRTPRRWSPNIQLKTYYLPSEGRRIRLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|254777316|ref|ZP_05218832.1| ribosomal protein L28 [Mycobacterium avium subsp. avium ATCC 25291] Length=78 Score = 105 bits (261), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 49/63 (78%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FG AVSHSHRRT RRW PNIQLK YYLPSE RR+++RVSA+GIKVID Sbjct 1 MSAHCQVTGRRPSFGNAVSHSHRRTPRRWSPNIQLKTYYLPSEGRRVRLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|118471258|ref|YP_890290.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155] gi|118172545|gb|ABK73441.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155] Length=78 Score = 104 bits (259), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 49/63 (78%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG +VSHSHRRT RRW PNIQ K YYLPSE RRI++RVSA+GIKVID Sbjct 1 MSAHCQVTGRGPGFGNSVSHSHRRTPRRWDPNIQNKTYYLPSEGRRIRLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|169627438|ref|YP_001701087.1| 50S ribosomal protein L28-2 [Mycobacterium abscessus ATCC 19977] gi|169239405|emb|CAM60433.1| 50S ribosomal protein L28-2 [Mycobacterium abscessus] Length=82 Score = 101 bits (252), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 51/63 (81%), Positives = 57/63 (91%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 +SA C++TGR+ GFG AVSHSHRRTRRRW PNIQLK YYLPSEDRRIK+RVS +GIKVID Sbjct 5 LSAHCEVTGRSPGFGNAVSHSHRRTRRRWSPNIQLKTYYLPSEDRRIKLRVSTKGIKVID 64 Query 61 RDG 63 RDG Sbjct 65 RDG 67 >gi|342859239|ref|ZP_08715893.1| ribosomal protein L28 [Mycobacterium colombiense CECT 3035] gi|342133480|gb|EGT86683.1| ribosomal protein L28 [Mycobacterium colombiense CECT 3035] Length=78 Score = 101 bits (251), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 48/63 (77%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG AVSHS RRT RR+ PN+QLK YYLPSE RRI++RVSA+GIKVID Sbjct 1 MSAHCQVTGRRPGFGNAVSHSGRRTSRRFNPNVQLKTYYLPSEGRRIRLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|54026949|ref|YP_121191.1| 50S ribosomal protein L28 [Nocardia farcinica IFM 10152] gi|67461561|sp|Q5YPR4.1|RL282_NOCFA RecName: Full=50S ribosomal protein L28 2 gi|54018457|dbj|BAD59827.1| putative ribosomal protein L28 [Nocardia farcinica IFM 10152] Length=78 Score = 100 bits (248), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSH RT RRW PNIQ K YYLPSE RRI + VSA+GIK ID Sbjct 1 MSAHCQVTGRKPGFGKSVSHSHVRTNRRWDPNIQRKTYYLPSEGRRITLTVSAKGIKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|111022583|ref|YP_705555.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1] gi|110822113|gb|ABG97397.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1] Length=78 Score = 99.4 bits (246), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSH+RT RRW PNIQ K Y+LPSE RR+ + +SA+GIK ID Sbjct 1 MSAHCQVTGRQPGFGKSVSHSHKRTNRRWDPNIQKKTYFLPSEGRRVTLTLSAKGIKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|319950952|ref|ZP_08024824.1| 50S ribosomal protein L28 [Dietzia cinnamea P4] gi|319435374|gb|EFV90622.1| 50S ribosomal protein L28 [Dietzia cinnamea P4] Length=78 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSHRRT RRW PNIQ ++Y+LPSE RR+ + VS +GIK ID Sbjct 1 MSAHCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSYFLPSEGRRVTLTVSTKGIKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|120406435|ref|YP_956264.1| 50S ribosomal protein L28 [Mycobacterium vanbaalenii PYR-1] gi|119959253|gb|ABM16258.1| LSU ribosomal protein L28P [Mycobacterium vanbaalenii PYR-1] Length=78 Score = 98.2 bits (243), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 51/63 (81%), Positives = 55/63 (88%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG AVSHSHRRTRRRW PNIQ K YYLPSE RR+K+RVSA+GIKVID Sbjct 1 MSAHCQVTGRAPGFGNAVSHSHRRTRRRWNPNIQTKTYYLPSEGRRVKLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|226365090|ref|YP_002782873.1| 50S ribosomal protein L28 [Rhodococcus opacus B4] gi|226243580|dbj|BAH53928.1| 50S ribosomal protein L28 [Rhodococcus opacus B4] Length=78 Score = 98.2 bits (243), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSH+RT RRW PNIQ K Y LPSE RRI + +SA+GIK +D Sbjct 1 MSAHCQVTGRKPGFGKSVSHSHKRTNRRWDPNIQKKTYLLPSEGRRITLTLSAKGIKTVD 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|118619876|ref|YP_908208.1| 50S ribosomal protein L28 RpmB2 [Mycobacterium ulcerans Agy99] gi|183980323|ref|YP_001848614.1| 50S ribosomal protein L28 RpmB2 [Mycobacterium marinum M] gi|118571986|gb|ABL06737.1| 50S ribosomal protein L28 RpmB2 [Mycobacterium ulcerans Agy99] gi|183173649|gb|ACC38759.1| 50S ribosomal protein L28 RpmB2 [Mycobacterium marinum M] Length=78 Score = 97.1 bits (240), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 53/63 (85%), Positives = 58/63 (93%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSARCQ+TGRTV FG VSHSHRR+RRRW PNIQLK YYLPSE+RRIK+RVSA+GIKVID Sbjct 1 MSARCQVTGRTVSFGNTVSHSHRRSRRRWSPNIQLKTYYLPSENRRIKLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|334563965|ref|ZP_08516956.1| 50S ribosomal protein L28 [Corynebacterium bovis DSM 20582] Length=78 Score = 97.1 bits (240), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSHRRT RRW PNIQ +++YLPSE R I + VS +G+K ID Sbjct 1 MSAHCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSFYLPSEGRSITLNVSTKGLKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|254818909|ref|ZP_05223910.1| 50S ribosomal protein L28 [Mycobacterium intracellulare ATCC 13950] Length=82 Score = 97.1 bits (240), Expect = 9e-19, Method: Compositional matrix adjust. Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 +SA CQ+TGR GFG AVSHSHRRTRRRW PNIQLK YYLPSE RRI++RVSA+GIKVID Sbjct 5 VSAHCQVTGRRPGFGNAVSHSHRRTRRRWSPNIQLKTYYLPSEGRRIRLRVSAKGIKVID 64 Query 61 RDG 63 RDG Sbjct 65 RDG 67 >gi|325676326|ref|ZP_08156005.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707] gi|325552887|gb|EGD22570.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707] Length=78 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG++VSHSHRRT RRW PNIQ K Y+LP E RRI +RV+ +GI+ ID Sbjct 1 MSAHCQVTGRRPGFGRSVSHSHRRTNRRWNPNIQTKTYFLPGEGRRITLRVTPKGIRTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|227487783|ref|ZP_03918099.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC 51867] gi|227542424|ref|ZP_03972473.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC 51866] gi|227092285|gb|EEI27597.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC 51867] gi|227181622|gb|EEI62594.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC 51866] Length=78 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSHRRT RRW PNIQ + +YLPSE R I + VS +G+KVID Sbjct 1 MSAICQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRKFYLPSEGRTITLNVSTKGLKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|229495046|ref|ZP_04388792.1| ribosomal protein L28 [Rhodococcus erythropolis SK121] gi|229317977|gb|EEN83852.1| ribosomal protein L28 [Rhodococcus erythropolis SK121] Length=78 Score = 95.9 bits (237), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 50/63 (80%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSH+R+ RRW PNIQ K Y LPSE RRI + +S +GIK ID Sbjct 1 MSAHCQVTGRVPGFGKSVSHSHKRSNRRWNPNIQRKTYLLPSEGRRITLTLSTKGIKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|226307890|ref|YP_002767850.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4] gi|226187007|dbj|BAH35111.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4] Length=78 Score = 95.5 bits (236), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 50/63 (80%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSH+R+ RRW PNIQ K Y LPSE RRI + +S +GIK ID Sbjct 1 MSAHCQVTGRVPGFGKSVSHSHKRSNRRWNPNIQRKTYVLPSEGRRITLTLSTKGIKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|340795037|ref|YP_004760500.1| 50S ribosomal protein L28 [Corynebacterium variabile DSM 44702] gi|340534947|gb|AEK37427.1| 50S ribosomal protein L28 [Corynebacterium variabile DSM 44702] Length=78 Score = 95.1 bits (235), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK+VSHSHRRT RRW PNIQ +++Y+PSE R I + VS +G+K ID Sbjct 1 MSAYCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSFYVPSEGRTITLNVSTKGLKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|38233448|ref|NP_939215.1| 50S ribosomal protein L28 [Corynebacterium diphtheriae NCTC 13129] gi|67461437|sp|Q6NIC6.1|RL28_CORDI RecName: Full=50S ribosomal protein L28 gi|38199708|emb|CAE49368.1| 50S ribosomal protein L28-2 [Corynebacterium diphtheriae] Length=78 Score = 94.4 bits (233), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR G+GK+VSHSHRRT RRW PN+Q + +YLPSE R I + VS +G+KVID Sbjct 1 MSAICQVTGRQPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLNVSTKGLKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|305681979|ref|ZP_07404783.1| 50S ribosomal protein L28 [Corynebacterium matruchotii ATCC 14266] gi|305658452|gb|EFM47955.1| 50S ribosomal protein L28 [Corynebacterium matruchotii ATCC 14266] Length=111 Score = 94.0 bits (232), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR G+GK+VSHSHRRT RRW PN+Q + +YLPSE R I + VS +G+KVID Sbjct 34 MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLTVSTKGLKVID 93 Query 61 RDG 63 RDG Sbjct 94 RDG 96 >gi|300858075|ref|YP_003783058.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis FRC41] gi|337290323|ref|YP_004629344.1| 50S ribosomal protein L28 [Corynebacterium ulcerans BR-AD22] gi|300685529|gb|ADK28451.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis FRC41] 6 more sequence titles Length=78 Score = 94.0 bits (232), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR G+GK+VSHSHRRT RRW PN+Q + +YLPSE R I + VS +G+KVID Sbjct 1 MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLNVSTKGLKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|68536621|ref|YP_251326.1| 50S ribosomal protein L28 [Corynebacterium jeikeium K411] gi|260577822|ref|ZP_05845756.1| 50S ribosomal protein L28 [Corynebacterium jeikeium ATCC 43734] gi|123650515|sp|Q4JTZ9.1|RL28_CORJK RecName: Full=50S ribosomal protein L28 gi|68264220|emb|CAI37708.1| 50S ribosomal protein L28 [Corynebacterium jeikeium K411] gi|258604049|gb|EEW17292.1| 50S ribosomal protein L28 [Corynebacterium jeikeium ATCC 43734] Length=78 Score = 94.0 bits (232), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK+VSHSHRRT RRW PNIQ + +YLPSE R I + VS +G+K ID Sbjct 1 MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRTFYLPSEGRSITLNVSTKGLKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|262201431|ref|YP_003272639.1| 50S ribosomal protein L28 [Gordonia bronchialis DSM 43247] gi|262084778|gb|ACY20746.1| ribosomal protein L28 [Gordonia bronchialis DSM 43247] Length=78 Score = 94.0 bits (232), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSARCQ+TG T GFG VSHSHR+TRRRW PNIQ + +Y+P+EDR I + VSA+G+K ID Sbjct 1 MSARCQVTGATPGFGNRVSHSHRKTRRRWNPNIQRRRFYIPAEDRHITLNVSAKGLKTID 60 Query 61 RDG 63 R G Sbjct 61 RHG 63 >gi|145221904|ref|YP_001132582.1| ribosomal protein L28 [Mycobacterium gilvum PYR-GCK] gi|315446360|ref|YP_004079239.1| 50S ribosomal protein L28P [Mycobacterium sp. Spyr1] gi|145214390|gb|ABP43794.1| LSU ribosomal protein L28P [Mycobacterium gilvum PYR-GCK] gi|315264663|gb|ADU01405.1| LSU ribosomal protein L28P [Mycobacterium sp. Spyr1] Length=78 Score = 94.0 bits (232), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 49/63 (78%), Positives = 53/63 (85%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG AVSHSHRRTRRRW PNIQ K YYLPSE RRI +RVS +GIK+ID Sbjct 1 MSAHCQVTGRKPGFGNAVSHSHRRTRRRWDPNIQRKTYYLPSEGRRITLRVSTKGIKIID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|317506812|ref|ZP_07964586.1| ribosomal protein L28 [Segniliparus rugosus ATCC BAA-974] gi|316254886|gb|EFV14182.1| ribosomal protein L28 [Segniliparus rugosus ATCC BAA-974] Length=78 Score = 93.6 bits (231), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG AVSHSHRRT RRW PNIQ + Y+LPSE R I + VSA+GIK ID Sbjct 1 MSAHCQVTGRQPGFGMAVSHSHRRTNRRWNPNIQRRRYFLPSEGRTITLNVSAKGIKTID 60 Query 61 RDG 63 R G Sbjct 61 RKG 63 >gi|296118268|ref|ZP_06836849.1| ribosomal protein L28 [Corynebacterium ammoniagenes DSM 20306] gi|295968826|gb|EFG82070.1| ribosomal protein L28 [Corynebacterium ammoniagenes DSM 20306] Length=78 Score = 93.6 bits (231), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK VSHSHRRT RRW PN+Q + YYLPSE R I + VS +GIK+ID Sbjct 1 MSAICQVTGREPSFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGIKIID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|336326218|ref|YP_004606184.1| 50S ribosomal protein L28 [Corynebacterium resistens DSM 45100] gi|336102200|gb|AEI10020.1| 50S ribosomal protein L28 [Corynebacterium resistens DSM 45100] Length=78 Score = 93.2 bits (230), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK VSHSHRRT RRW PNIQ +++YLPSE R I + VS +G+K ID Sbjct 1 MSAHCQVTGREPKFGKTVSHSHRRTSRRWNPNIQRRSFYLPSEGRTITLNVSTKGLKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|227504195|ref|ZP_03934244.1| 50S ribosomal protein L28 [Corynebacterium striatum ATCC 6940] gi|227199239|gb|EEI79287.1| 50S ribosomal protein L28 [Corynebacterium striatum ATCC 6940] Length=78 Score = 92.8 bits (229), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK VSHSHRRT RRW PN+Q + YYLPSE R I + VS +GIK+ID Sbjct 1 MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGIKIID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|343928748|ref|ZP_08768193.1| 50S ribosomal protein L28 [Gordonia alkanivorans NBRC 16433] gi|343761497|dbj|GAA15119.1| 50S ribosomal protein L28 [Gordonia alkanivorans NBRC 16433] Length=88 Score = 92.8 bits (229), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 47/73 (65%), Positives = 52/73 (72%), Gaps = 0/73 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MS RCQ+TGR GFGK VSHSHRRT RRW PNIQ K Y++PSE R I +RVSA+GI ID Sbjct 11 MSRRCQVTGREPGFGKQVSHSHRRTSRRWDPNIQRKRYFVPSEGRYITLRVSAKGISTID 70 Query 61 RDGHRGRRRAARA 73 R G R RA Sbjct 71 RYGIESVLRTMRA 83 >gi|19552095|ref|NP_600097.1| 50S ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032] gi|62389758|ref|YP_225160.1| 50S ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032] gi|145295039|ref|YP_001137860.1| 50S ribosomal protein L28 [Corynebacterium glutamicum R] 6 more sequence titles Length=78 Score = 92.4 bits (228), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 41/63 (66%), Positives = 50/63 (80%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK+VSHSHRRT RRW PN+Q + +Y+PSE R I + VS +G+KVID Sbjct 1 MSAHCQVTGRKPSFGKSVSHSHRRTSRRWNPNVQRRKFYVPSEGRTITLTVSTKGLKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|296393677|ref|YP_003658561.1| 50S ribosomal protein L28 [Segniliparus rotundus DSM 44985] gi|296180824|gb|ADG97730.1| ribosomal protein L28 [Segniliparus rotundus DSM 44985] Length=78 Score = 92.4 bits (228), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 48/63 (77%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFG AVSHSHRRT RRW PNIQ + Y+LPSE R I + VS +GIK ID Sbjct 1 MSAHCQVTGRQPGFGMAVSHSHRRTNRRWNPNIQRRRYFLPSEGRTITLNVSTKGIKTID 60 Query 61 RDG 63 R G Sbjct 61 RKG 63 >gi|227501466|ref|ZP_03931515.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49725] gi|255324830|ref|ZP_05365943.1| ribosomal protein L28 [Corynebacterium tuberculostearicum SK141] gi|306835627|ref|ZP_07468636.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49726] gi|311740878|ref|ZP_07714705.1| 50S ribosomal protein L28 [Corynebacterium pseudogenitalium ATCC 33035] gi|227077491|gb|EEI15454.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49725] gi|255298130|gb|EET77434.1| ribosomal protein L28 [Corynebacterium tuberculostearicum SK141] gi|304568471|gb|EFM44027.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49726] gi|311304398|gb|EFQ80474.1| 50S ribosomal protein L28 [Corynebacterium pseudogenitalium ATCC 33035] Length=78 Score = 92.0 bits (227), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK VSHSHRRT RRW PN+Q + YYLPSE R I + VS +G+K+ID Sbjct 1 MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGMKIID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|227832650|ref|YP_002834357.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC 700975] gi|262182865|ref|ZP_06042286.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC 700975] gi|254801353|sp|C3PF15.1|RL28_CORA7 RecName: Full=50S ribosomal protein L28 gi|227453666|gb|ACP32419.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC 700975] Length=78 Score = 91.3 bits (225), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK VSHSHRRT RRW PN+Q + YYLPSE R I + VS +G+K+ID Sbjct 1 MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLTVSTKGMKIID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|237785096|ref|YP_002905801.1| 50S ribosomal protein L28 [Corynebacterium kroppenstedtii DSM 44385] gi|259646731|sp|C4LHF3.1|RL28_CORK4 RecName: Full=50S ribosomal protein L28 gi|237758008|gb|ACR17258.1| 50S ribosomal protein L28 [Corynebacterium kroppenstedtii DSM 44385] Length=78 Score = 90.9 bits (224), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 41/63 (66%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK+VSHSHRRT RRW PNIQ +++YLPSE R I + VS +G+K ID Sbjct 1 MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRSFYLPSEGRTITLNVSTKGLKTID 60 Query 61 RDG 63 R G Sbjct 61 RYG 63 >gi|172040222|ref|YP_001799936.1| 50S ribosomal protein L28 [Corynebacterium urealyticum DSM 7109] gi|226738059|sp|B1VFG3.1|RL28_CORU7 RecName: Full=50S ribosomal protein L28 gi|171851526|emb|CAQ04502.1| 50S ribosomal protein L28 [Corynebacterium urealyticum DSM 7109] Length=78 Score = 90.5 bits (223), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 41/63 (66%), Positives = 48/63 (77%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK VSHSHR T RRW PN+Q + +YLPSE R I + VS +G+K ID Sbjct 1 MSAYCQVTGRKPGFGKQVSHSHRHTSRRWNPNVQRRKFYLPSEGRTITLTVSPKGLKTID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|326383108|ref|ZP_08204797.1| ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395] gi|326198244|gb|EGD55429.1| ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395] Length=78 Score = 90.5 bits (223), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 41/63 (66%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 M+ARCQ+TGR GFG+ VSHSHRRT R+W PN+ K Y++PS R + +RVSA+GIKVID Sbjct 1 MAARCQVTGRVPGFGRQVSHSHRRTSRQWRPNLFRKTYWVPSLSRNVTLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|25027499|ref|NP_737553.1| 50S ribosomal protein L28 [Corynebacterium efficiens YS-314] gi|67461532|sp|Q8FR24.1|RL28_COREF RecName: Full=50S ribosomal protein L28 gi|23492781|dbj|BAC17753.1| putative 50S ribosomal protein L28 [Corynebacterium efficiens YS-314] Length=78 Score = 88.2 bits (217), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK+VSHSHRRT RRW PN+Q + +++PS R I + VS +G+KVID Sbjct 1 MSAHCQVTGRQPSFGKSVSHSHRRTSRRWNPNVQRRKFFVPSMGRTITLTVSTKGLKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|108801694|ref|YP_641891.1| 50S ribosomal protein L28 [Mycobacterium sp. MCS] gi|119870845|ref|YP_940797.1| 50S ribosomal protein L28 [Mycobacterium sp. KMS] gi|126437680|ref|YP_001073371.1| 50S ribosomal protein L28 [Mycobacterium sp. JLS] gi|108772113|gb|ABG10835.1| LSU ribosomal protein L28P [Mycobacterium sp. MCS] gi|119696934|gb|ABL94007.1| LSU ribosomal protein L28P [Mycobacterium sp. KMS] gi|126237480|gb|ABO00881.1| LSU ribosomal protein L28P [Mycobacterium sp. JLS] Length=78 Score = 87.8 bits (216), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 48/63 (77%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR+ GFG VSHSHRRTRRRW PNIQ K YY+PSE RR+ +RVSA+GIKVID Sbjct 1 MSAHCQVTGRSPGFGNRVSHSHRRTRRRWRPNIQTKTYYVPSEGRRVTLRVSAKGIKVID 60 Query 61 RDG 63 RDG Sbjct 61 RDG 63 >gi|302527617|ref|ZP_07279959.1| ribosomal protein L28 [Streptomyces sp. AA4] gi|302436512|gb|EFL08328.1| ribosomal protein L28 [Streptomyces sp. AA4] Length=78 Score = 86.3 bits (212), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/63 (61%), Positives = 50/63 (80%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR G+GK VSHSHRRT RRW PN+Q + YY+PS R ++++VSA+G+K ID Sbjct 1 MSAVCQVTGRKPGYGKQVSHSHRRTSRRWEPNLQTRRYYVPSLGRTVRLKVSAKGMKTID 60 Query 61 RDG 63 + G Sbjct 61 KRG 63 >gi|296140972|ref|YP_003648215.1| 50S ribosomal protein L28 [Tsukamurella paurometabola DSM 20162] gi|296029106|gb|ADG79876.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162] Length=78 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 48/63 (77%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR GFGK VSHSH RT RRW PNIQ + YY+PS R + +RVSA+GIK ID Sbjct 1 MSAHCQVTGRAPGFGKRVSHSHVRTSRRWDPNIQRRRYYVPSLGRTVVLRVSAKGIKTID 60 Query 61 RDG 63 R G Sbjct 61 RRG 63 >gi|258653985|ref|YP_003203141.1| 50S ribosomal protein L28 [Nakamurella multipartita DSM 44233] gi|258557210|gb|ACV80152.1| ribosomal protein L28 [Nakamurella multipartita DSM 44233] Length=78 Score = 85.1 bits (209), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSARCQ+TG GFGK+VSHSH+RT RRW PN+Q + +Y+PS R +++RVS +G+++ID Sbjct 1 MSARCQVTGAEPGFGKSVSHSHQRTNRRWEPNLQHRRFYVPSLRRTVRLRVSTKGLRIID 60 Query 61 RDG 63 R G Sbjct 61 RRG 63 >gi|312138607|ref|YP_004005943.1| 50S ribosomal protein l28 rpmb [Rhodococcus equi 103S] gi|311887946|emb|CBH47258.1| 50S ribosomal protein L28 RpmB [Rhodococcus equi 103S] Length=72 Score = 85.1 bits (209), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%) Query 7 ITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDG 63 +TGR GFG++VSHSHRRT RRW PNIQ K Y+LP E RRI +RV+ +GI+ IDRDG Sbjct 1 MTGRRPGFGRSVSHSHRRTNRRWNPNIQTKTYFLPGEGRRITLRVTPKGIRTIDRDG 57 >gi|134097360|ref|YP_001103021.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338] gi|291009081|ref|ZP_06567054.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338] gi|133909983|emb|CAM00095.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338] Length=78 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MS RCQ+TG+ G+GK VSHSH RT RRW PN+Q + Y+LPSE R +++R+SA+ +K ID Sbjct 1 MSVRCQVTGKKPGYGKQVSHSHVRTNRRWMPNVQRRRYWLPSEGRWVRLRLSAKAMKTID 60 Query 61 RDG 63 R G Sbjct 61 RRG 63 >gi|323358133|ref|YP_004224529.1| ribosomal protein L28 [Microbacterium testaceum StLB037] gi|323274504|dbj|BAJ74649.1| ribosomal protein L28 [Microbacterium testaceum StLB037] Length=78 Score = 84.0 bits (206), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 38/63 (61%), Positives = 48/63 (77%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 M+A CQ+TG GFG +SHSHRRT+RR+ PN+Q K Y++PS R IK+ VSA+GIKVID Sbjct 1 MAAVCQVTGAVPGFGHNISHSHRRTKRRFDPNVQKKTYFVPSLGRNIKLNVSAKGIKVID 60 Query 61 RDG 63 G Sbjct 61 ARG 63 >gi|213966101|ref|ZP_03394289.1| conserved domain protein [Corynebacterium amycolatum SK46] gi|213951299|gb|EEB62693.1| conserved domain protein [Corynebacterium amycolatum SK46] Length=135 Score = 84.0 bits (206), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 39/63 (62%), Positives = 46/63 (74%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 MSA CQ+TGR FGK VSHSHRRT RRW PN+Q K +YL SE R I + VS +G+K ID Sbjct 58 MSAICQVTGRKPSFGKTVSHSHRRTSRRWNPNVQRKKFYLASEGRHITLNVSPKGLKTID 117 Query 61 RDG 63 + G Sbjct 118 KYG 120 >gi|295394905|ref|ZP_06805118.1| 50S ribosomal protein L28 [Brevibacterium mcbrellneri ATCC 49030] gi|294972238|gb|EFG48100.1| 50S ribosomal protein L28 [Brevibacterium mcbrellneri ATCC 49030] Length=78 Score = 84.0 bits (206), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 40/63 (64%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 M+A CQ+TG T GFG VSHS+RRT+RR+ PNIQ K YY+PS R + + VSA+GIKVID Sbjct 1 MAAVCQVTGTTPGFGHNVSHSNRRTKRRFDPNIQKKKYYVPSLRRNVTLTVSARGIKVID 60 Query 61 RDG 63 R G Sbjct 61 RRG 63 >gi|50955925|ref|YP_063213.1| 50S ribosomal protein L28 [Leifsonia xyli subsp. xyli str. CTCB07] gi|67461387|sp|Q6ABY4.1|RL28_LEIXX RecName: Full=50S ribosomal protein L28 gi|50952407|gb|AAT90108.1| 50S ribosomal protein L28 [Leifsonia xyli subsp. xyli str. CTCB07] Length=78 Score = 84.0 bits (206), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 38/63 (61%), Positives = 49/63 (78%), Gaps = 0/63 (0%) Query 1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID 60 M+A CQ+TG T GFG ++SHSHRRT+RR+ PNIQ K YY+PS R + + +SA+GIKVID Sbjct 1 MAAVCQVTGATPGFGHSISHSHRRTKRRFDPNIQKKTYYVPSLRRNVTLTLSAKGIKVID 60 Query 61 RDG 63 G Sbjct 61 ARG 63 Lambda K H 0.324 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 127354591080 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40