BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0186A Length=53 Score E Sequences producing significant alignments: (Bits) Value gi|15839565|ref|NP_334602.1| hypothetical protein MT0196 [Mycoba... 109 1e-22 gi|289568086|ref|ZP_06448313.1| conserved hypothetical protein [... 104 4e-21 gi|167970308|ref|ZP_02552585.1| hypothetical protein MtubH3_2068... 100 9e-20 gi|296167404|ref|ZP_06849806.1| conserved hypothetical protein [... 88.2 4e-16 gi|41409724|ref|NP_962560.1| hypothetical protein MAP3626c [Myco... 85.5 2e-15 gi|336460067|gb|EGO38976.1| hypothetical protein MAPs_44490 [Myc... 83.6 9e-15 >gi|15839565|ref|NP_334602.1| hypothetical protein MT0196 [Mycobacterium tuberculosis CDC1551] gi|313471345|sp|P0CI28.1|MYMT_MYCTU RecName: Full=Metallothionein; Short=MT; AltName: Full=Copper-binding metallothionein; Short=Cu(I)-binding metallothionein; AltName: Full=Mycobacterial metallothionein; Flags: Precursor gi|13879678|gb|AAK44416.1| hypothetical protein MT0196 [Mycobacterium tuberculosis CDC1551] Length=53 Score = 109 bits (273), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%) Query 1 MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK Sbjct 1 MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 >gi|289568086|ref|ZP_06448313.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289541839|gb|EFD45488.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] Length=51 Score = 104 bits (260), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 50/51 (99%), Positives = 51/51 (100%), Gaps = 0/51 (0%) Query 3 VIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 +IRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK Sbjct 1 MIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 51 >gi|167970308|ref|ZP_02552585.1| hypothetical protein MtubH3_20688 [Mycobacterium tuberculosis H37Ra] gi|254549126|ref|ZP_05139573.1| hypothetical protein Mtube_01451 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|294994660|ref|ZP_06800351.1| hypothetical protein Mtub2_09132 [Mycobacterium tuberculosis 210] gi|297632665|ref|ZP_06950445.1| hypothetical protein MtubK4_01001 [Mycobacterium tuberculosis KZN 4207] gi|297729640|ref|ZP_06958758.1| hypothetical protein MtubKR_01031 [Mycobacterium tuberculosis KZN R506] gi|313656966|ref|ZP_07813846.1| hypothetical protein MtubKV_01016 [Mycobacterium tuberculosis KZN V2475] gi|345462045|ref|YP_004837046.1| hypothetical protein Rv4014 [Mycobacterium tuberculosis H37Rv] Length=48 Score = 100 bits (248), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%) Query 6 MTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 MTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK Sbjct 1 MTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 48 >gi|296167404|ref|ZP_06849806.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295897348|gb|EFG76952.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=48 Score = 88.2 bits (217), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 41/48 (86%), Positives = 43/48 (90%), Gaps = 0/48 (0%) Query 6 MTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 M NYEAGT LTC HEGCGCRVRIEVPCHC+GAG+ YRCTCGDEL PVK Sbjct 1 MANYEAGTELTCGHEGCGCRVRIEVPCHCSGAGEPYRCTCGDELTPVK 48 >gi|41409724|ref|NP_962560.1| hypothetical protein MAP3626c [Mycobacterium avium subsp. paratuberculosis K-10] gi|118462867|ref|YP_884113.1| hypothetical protein MAV_4993 [Mycobacterium avium 104] gi|41398556|gb|AAS06176.1| hypothetical protein MAP_3626c [Mycobacterium avium subsp. paratuberculosis K-10] gi|118164154|gb|ABK65051.1| conserved hypothetical protein [Mycobacterium avium 104] Length=51 Score = 85.5 bits (210), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%) Query 5 RMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 M YE+GTLLTC HEGCGCRVRIEVPCHC+GAG+ YRCTCGD L PVK Sbjct 3 HMATYESGTLLTCGHEGCGCRVRIEVPCHCSGAGEEYRCTCGDALTPVK 51 >gi|336460067|gb|EGO38976.1| hypothetical protein MAPs_44490 [Mycobacterium avium subsp. paratuberculosis S397] Length=51 Score = 83.6 bits (205), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 38/46 (83%), Positives = 41/46 (90%), Gaps = 0/46 (0%) Query 8 NYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK 53 YE+GTLLTC HEGCGCRVRIEVPCHC+GAG+ YRCTCGD L PVK Sbjct 6 TYESGTLLTCGHEGCGCRVRIEVPCHCSGAGEEYRCTCGDALTPVK 51 Lambda K H 0.327 0.140 0.489 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 130244412240 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40