BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0236A Length=57 Score E Sequences producing significant alignments: (Bits) Value gi|15839617|ref|NP_334654.1| hypothetical protein MT0250 [Mycoba... 115 3e-24 gi|289748718|ref|ZP_06508096.1| secreted protein [Mycobacterium ... 114 6e-24 gi|31791414|ref|NP_853907.1| hypothetical protein Mb0242c [Mycob... 113 8e-24 gi|296167518|ref|ZP_06849870.1| conserved hypothetical protein [... 109 2e-22 gi|118472091|ref|YP_884773.1| hypothetical protein MSMEG_0360 [M... 98.6 3e-19 gi|108797207|ref|YP_637404.1| small secreted protein [Mycobacter... 96.7 1e-18 gi|145221021|ref|YP_001131699.1| small secreted protein [Mycobac... 96.7 1e-18 gi|120401280|ref|YP_951109.1| small secreted protein [Mycobacter... 96.3 1e-18 gi|240168461|ref|ZP_04747120.1| small secreted protein [Mycobact... 92.0 3e-17 gi|254777361|ref|ZP_05218877.1| hypothetical protein MaviaA2_222... 90.9 6e-17 gi|183980525|ref|YP_001848816.1| small secreted protein [Mycobac... 90.9 6e-17 gi|333988859|ref|YP_004521473.1| small secreted protein [Mycobac... 90.5 7e-17 gi|254820649|ref|ZP_05225650.1| hypothetical protein MintA_12011... 90.5 7e-17 gi|118616878|ref|YP_905210.1| small secreted protein [Mycobacter... 87.8 5e-16 gi|15828383|ref|NP_302646.1| hypothetical protein [Mycobacterium... 85.9 2e-15 gi|169631545|ref|YP_001705194.1| hypothetical protein MAB_4471 [... 83.2 1e-14 gi|118465903|ref|YP_884043.1| secreted protein [Mycobacterium av... 81.3 5e-14 gi|167968958|ref|ZP_02551235.1| hypothetical protein MtubH3_1336... 59.3 2e-07 gi|226304603|ref|YP_002764561.1| hypothetical protein RER_11140 ... 52.8 2e-05 gi|54027443|ref|YP_121685.1| hypothetical protein nfa54690 [Noca... 51.2 5e-05 gi|325673155|ref|ZP_08152848.1| hypothetical protein HMPREF0724_... 48.9 3e-04 gi|213965392|ref|ZP_03393588.1| conserved hypothetical protein [... 45.1 0.003 gi|312141424|ref|YP_004008760.1| hypothetical protein REQ_41130 ... 40.8 0.065 gi|25029228|ref|NP_739282.1| hypothetical protein CE2672 [Coryne... 40.8 0.069 gi|111022160|ref|YP_705132.1| hypothetical protein RHA1_ro05193 ... 35.8 1.9 gi|227501946|ref|ZP_03931995.1| conserved hypothetical protein [... 35.0 3.8 gi|296119067|ref|ZP_06837639.1| putative secreted protein [Coryn... 34.3 6.8 gi|339628139|ref|YP_004719782.1| 4-aminobutyrate aminotransferas... 33.9 8.5 >gi|15839617|ref|NP_334654.1| hypothetical protein MT0250 [Mycobacterium tuberculosis CDC1551] gi|13879734|gb|AAK44468.1| hypothetical protein MT0250 [Mycobacterium tuberculosis CDC1551] Length=182 Score = 115 bits (287), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 57/57 (100%), Positives = 57/57 (100%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS Sbjct 126 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 182 >gi|289748718|ref|ZP_06508096.1| secreted protein [Mycobacterium tuberculosis T92] gi|289756302|ref|ZP_06515680.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] gi|289689305|gb|EFD56734.1| secreted protein [Mycobacterium tuberculosis T92] gi|289696889|gb|EFD64318.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] Length=73 Score = 114 bits (284), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 57/57 (100%), Positives = 57/57 (100%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS Sbjct 17 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 73 >gi|31791414|ref|NP_853907.1| hypothetical protein Mb0242c [Mycobacterium bovis AF2122/97] gi|57116705|ref|YP_177619.1| hypothetical protein Rv0236A [Mycobacterium tuberculosis H37Rv] gi|121636149|ref|YP_976372.1| hypothetical protein BCG_0274c [Mycobacterium bovis BCG str. Pasteur 1173P2] 69 more sequence titles Length=57 Score = 113 bits (283), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 57/57 (100%), Positives = 57/57 (100%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 >gi|296167518|ref|ZP_06849870.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295897140|gb|EFG76749.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=62 Score = 109 bits (272), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 53/57 (93%), Positives = 55/57 (97%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRI+APAAASVVVGLLLGAAAIFG+TLMVQQD KPPLPGGDP SSVLNRVEYGNRS Sbjct 6 MNRIIAPAAASVVVGLLLGAAAIFGITLMVQQDTKPPLPGGDPQSSVLNRVEYGNRS 62 >gi|118472091|ref|YP_884773.1| hypothetical protein MSMEG_0360 [Mycobacterium smegmatis str. MC2 155] gi|118173378|gb|ABK74274.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2 155] Length=57 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 47/57 (83%), Positives = 52/57 (92%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNR V P+AAS+VVGLLLGAAA+FGVTLMVQQD KPPL GDP+SSVLNRVEYG+RS Sbjct 1 MNRFVVPSAASIVVGLLLGAAAVFGVTLMVQQDTKPPLQAGDPASSVLNRVEYGDRS 57 >gi|108797207|ref|YP_637404.1| small secreted protein [Mycobacterium sp. MCS] gi|119866292|ref|YP_936244.1| small secreted protein [Mycobacterium sp. KMS] gi|126432830|ref|YP_001068521.1| small secreted protein [Mycobacterium sp. JLS] gi|108767626|gb|ABG06348.1| small secreted protein [Mycobacterium sp. MCS] gi|119692381|gb|ABL89454.1| small secreted protein [Mycobacterium sp. KMS] gi|126232630|gb|ABN96030.1| small secreted protein [Mycobacterium sp. JLS] Length=57 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 45/57 (79%), Positives = 52/57 (92%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 M+R + PAAAS+VVGLLLGAAA+FGVTLMVQ+D KPPL GDP+SSVLNRVEYG+RS Sbjct 1 MDRFIVPAAASIVVGLLLGAAAVFGVTLMVQEDSKPPLQAGDPASSVLNRVEYGDRS 57 >gi|145221021|ref|YP_001131699.1| small secreted protein [Mycobacterium gilvum PYR-GCK] gi|315442007|ref|YP_004074886.1| hypothetical protein Mspyr1_03370 [Mycobacterium sp. Spyr1] gi|145213507|gb|ABP42911.1| small secreted protein [Mycobacterium gilvum PYR-GCK] gi|315260310|gb|ADT97051.1| hypothetical protein Mspyr1_03370 [Mycobacterium sp. Spyr1] Length=57 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 45/57 (79%), Positives = 52/57 (92%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNR + PAAAS+VVGLLLGAAA+FGVTLMVQ+D KPPL GDP+SSVLNRVEYG+R+ Sbjct 1 MNRFLVPAAASIVVGLLLGAAAVFGVTLMVQEDTKPPLQAGDPASSVLNRVEYGDRT 57 >gi|120401280|ref|YP_951109.1| small secreted protein [Mycobacterium vanbaalenii PYR-1] gi|119954098|gb|ABM11103.1| small secreted protein [Mycobacterium vanbaalenii PYR-1] Length=57 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 45/57 (79%), Positives = 52/57 (92%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 M+R + PAAAS+VVGLLLGAAA+FGVTLMVQQD KPPL GDP+SSVLNRVEYG+R+ Sbjct 1 MDRFLVPAAASIVVGLLLGAAAVFGVTLMVQQDTKPPLQAGDPASSVLNRVEYGDRT 57 >gi|240168461|ref|ZP_04747120.1| small secreted protein [Mycobacterium kansasii ATCC 12478] Length=57 Score = 92.0 bits (227), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 55/57 (97%), Positives = 56/57 (99%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFG+TLMVQQD KPPLPGGDPSSSVLNRVEYGNRS Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGITLMVQQDTKPPLPGGDPSSSVLNRVEYGNRS 57 >gi|254777361|ref|ZP_05218877.1| hypothetical protein MaviaA2_22201 [Mycobacterium avium subsp. avium ATCC 25291] gi|336460131|gb|EGO39037.1| Protein of unknown function (DUF2613) [Mycobacterium avium subsp. paratuberculosis S397] Length=57 Score = 90.9 bits (224), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 55/57 (97%), Positives = 55/57 (97%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQD KPPLPGGDP SSVLNRVEYGNRS Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDTKPPLPGGDPQSSVLNRVEYGNRS 57 >gi|183980525|ref|YP_001848816.1| small secreted protein [Mycobacterium marinum M] gi|183173851|gb|ACC38961.1| small secreted protein [Mycobacterium marinum M] Length=57 Score = 90.9 bits (224), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 54/57 (95%), Positives = 56/57 (99%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFG+T+MVQQD KPPLPGGDPSSSVLNRVEYGNRS Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGITVMVQQDTKPPLPGGDPSSSVLNRVEYGNRS 57 >gi|333988859|ref|YP_004521473.1| small secreted protein [Mycobacterium sp. JDM601] gi|333484827|gb|AEF34219.1| small secreted protein [Mycobacterium sp. JDM601] Length=57 Score = 90.5 bits (223), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNR 56 M R V PAA S+VVG+LLGAAA+FGVTLMVQQD KP + GGDP SSVLNRVEYGNR Sbjct 1 MPRFVVPAAISIVVGVLLGAAAVFGVTLMVQQDTKPQIAGGDPQSSVLNRVEYGNR 56 >gi|254820649|ref|ZP_05225650.1| hypothetical protein MintA_12011 [Mycobacterium intracellulare ATCC 13950] gi|342859289|ref|ZP_08715943.1| hypothetical protein MCOL_10433 [Mycobacterium colombiense CECT 3035] gi|342133530|gb|EGT86733.1| hypothetical protein MCOL_10433 [Mycobacterium colombiense CECT 3035] Length=57 Score = 90.5 bits (223), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 54/57 (95%), Positives = 55/57 (97%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFG+TLMVQQD KPPLPGGDP SSVLNRVEYGNRS Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGITLMVQQDTKPPLPGGDPQSSVLNRVEYGNRS 57 >gi|118616878|ref|YP_905210.1| small secreted protein [Mycobacterium ulcerans Agy99] gi|118568988|gb|ABL03739.1| small secreted protein [Mycobacterium ulcerans Agy99] Length=57 Score = 87.8 bits (216), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 53/57 (93%), Positives = 55/57 (97%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 MNRIVAPAAASVVVGLLLGAAAIFG+T+MVQQD KPPLP GDPSSSVLNRVEYGNRS Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGITVMVQQDTKPPLPRGDPSSSVLNRVEYGNRS 57 >gi|15828383|ref|NP_302646.1| hypothetical protein [Mycobacterium leprae TN] gi|221230860|ref|YP_002504276.1| putative secreted protein [Mycobacterium leprae Br4923] gi|18202777|sp|Q9CD20.1|Y256A_MYCLE RecName: Full=Putative secreted protein ML2569.1; Flags: Precursor gi|13093813|emb|CAC32101.1| putative secreted protein [Mycobacterium leprae] gi|219933967|emb|CAR72669.1| putative secreted protein [Mycobacterium leprae Br4923] Length=57 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 51/57 (90%), Positives = 54/57 (95%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 M+RIVAPAAASVVVGLLLGAA IFG+TLMVQQD KPPLPGGDP SSVLNRVEYGNR+ Sbjct 1 MSRIVAPAAASVVVGLLLGAATIFGMTLMVQQDTKPPLPGGDPQSSVLNRVEYGNRT 57 >gi|169631545|ref|YP_001705194.1| hypothetical protein MAB_4471 [Mycobacterium abscessus ATCC 19977] gi|169243512|emb|CAM64540.1| Hypothetical protein MAB_4471 [Mycobacterium abscessus] Length=57 Score = 83.2 bits (204), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 39/57 (69%), Positives = 49/57 (86%), Gaps = 0/57 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 M R V PAAASV++GLLLGAAA+FG+TL V+QDKKP + G DPS+++LNR +YGNRS Sbjct 1 MTRFVVPAAASVLIGLLLGAAAVFGLTLSVEQDKKPVVTGIDPSTAILNRPDYGNRS 57 >gi|118465903|ref|YP_884043.1| secreted protein [Mycobacterium avium 104] gi|118167190|gb|ABK68087.1| putative secreted protein [Mycobacterium avium 104] Length=41 Score = 81.3 bits (199), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 38/41 (93%), Positives = 39/41 (96%), Gaps = 0/41 (0%) Query 17 LLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 +LGAAAIFGVTLMVQQD KPPLPGGDP SSVLNRVEYGNRS Sbjct 1 MLGAAAIFGVTLMVQQDTKPPLPGGDPQSSVLNRVEYGNRS 41 >gi|167968958|ref|ZP_02551235.1| hypothetical protein MtubH3_13367 [Mycobacterium tuberculosis H37Ra] Length=54 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 40/41 (98%), Positives = 40/41 (98%), Gaps = 0/41 (0%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGG 41 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLP G Sbjct 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPRG 41 >gi|226304603|ref|YP_002764561.1| hypothetical protein RER_11140 [Rhodococcus erythropolis PR4] gi|229494171|ref|ZP_04387934.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|226183718|dbj|BAH31822.1| conserved hypothetical protein [Rhodococcus erythropolis PR4] gi|229318533|gb|EEN84391.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length=57 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/57 (46%), Positives = 36/57 (64%), Gaps = 1/57 (1%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLP-GGDPSSSVLNRVEYGNR 56 M + + P AS V+G +LGA IFGVT + +P + G+ SSVLN+VEYG+R Sbjct 1 MTKFLVPGVASAVIGAVLGAGVIFGVTAAASDNTRPEIDRSGNADSSVLNQVEYGSR 57 >gi|54027443|ref|YP_121685.1| hypothetical protein nfa54690 [Nocardia farcinica IFM 10152] gi|54018951|dbj|BAD60321.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=56 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 25/55 (46%), Positives = 34/55 (62%), Gaps = 1/55 (1%) Query 3 RIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLP-GGDPSSSVLNRVEYGNR 56 + P AS V G +LG A+F +T VQQ+ +P + GD SS+LN VEYG+R Sbjct 2 KFAVPGVASAVAGAVLGVIAVFAITAAVQQNSRPEIDRSGDADSSLLNSVEYGSR 56 >gi|325673155|ref|ZP_08152848.1| hypothetical protein HMPREF0724_10629 [Rhodococcus equi ATCC 33707] gi|325555990|gb|EGD25659.1| hypothetical protein HMPREF0724_10629 [Rhodococcus equi ATCC 33707] Length=57 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 24/57 (43%), Positives = 37/57 (65%), Gaps = 1/57 (1%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLP-GGDPSSSVLNRVEYGNR 56 M + + P AS V+G ++GA A+ GVT Q + P + G+ +SS+LN+VEYG+R Sbjct 1 MAKFLVPGVASAVIGAVVGAGAVLGVTAAAQDNTLPDIDRSGNANSSILNQVEYGSR 57 >gi|213965392|ref|ZP_03393588.1| conserved hypothetical protein [Corynebacterium amycolatum SK46] gi|213952008|gb|EEB63394.1| conserved hypothetical protein [Corynebacterium amycolatum SK46] Length=64 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/55 (42%), Positives = 31/55 (57%), Gaps = 0/55 (0%) Query 2 NRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNR 56 R V PA AS ++G LLG AAIFG+ + +D+ P ++L VEYG R Sbjct 10 RRSVGPALASALIGALLGGAAIFGIGQALTEDRIPEAQAVSTDDALLGGVEYGQR 64 >gi|312141424|ref|YP_004008760.1| hypothetical protein REQ_41130 [Rhodococcus equi 103S] gi|311890763|emb|CBH50082.1| putative secreted protein [Rhodococcus equi 103S] Length=45 Score = 40.8 bits (94), Expect = 0.065, Method: Compositional matrix adjust. Identities = 19/45 (43%), Positives = 31/45 (69%), Gaps = 1/45 (2%) Query 13 VVGLLLGAAAIFGVTLMVQQDKKPPLP-GGDPSSSVLNRVEYGNR 56 ++G ++GA A+ GVT Q + P + G+ +SS+LN+VEYG+R Sbjct 1 MIGAVVGAGAVLGVTAAAQDNTLPDIDRSGNANSSILNQVEYGSR 45 >gi|25029228|ref|NP_739282.1| hypothetical protein CE2672 [Corynebacterium efficiens YS-314] gi|259505772|ref|ZP_05748674.1| secreted protein [Corynebacterium efficiens YS-314] gi|23494516|dbj|BAC19482.1| hypothetical protein [Corynebacterium efficiens YS-314] gi|259166631|gb|EEW51185.1| secreted protein [Corynebacterium efficiens YS-314] Length=85 Score = 40.8 bits (94), Expect = 0.069, Method: Compositional matrix adjust. Identities = 22/54 (41%), Positives = 31/54 (58%), Gaps = 0/54 (0%) Query 3 RIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNR 56 R + PA AS VVG+ LGA A+ GV+++ QD P ++L EYG+R Sbjct 11 RTIGPAVASAVVGIALGAVAVAGVSVLAGQDTVPSSNAVTADDALLGGPEYGSR 64 >gi|111022160|ref|YP_705132.1| hypothetical protein RHA1_ro05193 [Rhodococcus jostii RHA1] gi|226364653|ref|YP_002782435.1| hypothetical protein ROP_52430 [Rhodococcus opacus B4] gi|110821690|gb|ABG96974.1| conserved hypothetical protein [Rhodococcus jostii RHA1] gi|226243142|dbj|BAH53490.1| hypothetical protein [Rhodococcus opacus B4] Length=57 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 23/57 (41%), Positives = 34/57 (60%), Gaps = 1/57 (1%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLP-GGDPSSSVLNRVEYGNR 56 M + + P S VVG+ LG A G+T Q + +P + G+ SS+LN+VEYG+R Sbjct 1 MGKFLVPGVVSAVVGVALGTVATLGITAAAQDNTRPEIDRSGNADSSLLNQVEYGSR 57 >gi|227501946|ref|ZP_03931995.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49725] gi|306837055|ref|ZP_07469999.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49726] gi|227077330|gb|EEI15293.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49725] gi|304567067|gb|EFM42688.1| conserved hypothetical protein [Corynebacterium accolens ATCC 49726] Length=65 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 20/55 (37%), Positives = 26/55 (48%), Gaps = 0/55 (0%) Query 3 RIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS 57 R + PA S VVG+ LG I G+ D P P +VL EYG+R+ Sbjct 11 RTLGPAVGSAVVGIALGIITIIGIAQFSGSDTVPEGNAVSPDDAVLGGPEYGSRT 65 >gi|296119067|ref|ZP_06837639.1| putative secreted protein [Corynebacterium ammoniagenes DSM 20306] gi|295967902|gb|EFG81155.1| putative secreted protein [Corynebacterium ammoniagenes DSM 20306] Length=58 Score = 34.3 bits (77), Expect = 6.8, Method: Compositional matrix adjust. Identities = 21/54 (39%), Positives = 25/54 (47%), Gaps = 0/54 (0%) Query 3 RIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNR 56 R PA SVVVG+ LG + GV QD P +VL EYG+R Sbjct 4 RTFGPALGSVVVGIALGIVTVIGVAQFSGQDSVPSGHAVPADDAVLGSPEYGSR 57 >gi|339628139|ref|YP_004719782.1| 4-aminobutyrate aminotransferase related aminotransferase [Sulfobacillus acidophilus TPY] gi|339285928|gb|AEJ40039.1| 4-aminobutyrate aminotransferase related aminotransferase [Sulfobacillus acidophilus TPY] Length=451 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/51 (40%), Positives = 31/51 (61%), Gaps = 2/51 (3%) Query 1 MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRV 51 M+R+ A S V+G + G A+ GV L+ QDKK P G+ +S +L+R+ Sbjct 356 MSRLKAIQEKSPVIGEVRGLGAMVGVELV--QDKKTKEPAGELTSRILHRM 404 Lambda K H 0.316 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128599645896 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40