BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0300 Length=73 Score E Sequences producing significant alignments: (Bits) Value gi|339293356|gb|AEJ45467.1| hypothetical protein CCDC5079_0277 [... 140 8e-32 gi|15607441|ref|NP_214814.1| hypothetical protein Rv0300 [Mycoba... 138 3e-31 gi|306774397|ref|ZP_07412734.1| antitoxin [Mycobacterium tubercu... 137 6e-31 gi|284034115|ref|YP_003384046.1| hypothetical protein Kfla_6244 ... 90.9 5e-17 gi|297564352|ref|YP_003683325.1| hypothetical protein Ndas_5440 ... 63.2 1e-08 gi|296128791|ref|YP_003636041.1| hypothetical protein Cfla_0934 ... 57.4 6e-07 gi|336117847|ref|YP_004572615.1| hypothetical protein MLP_21980 ... 52.0 3e-05 gi|336119998|ref|YP_004574776.1| hypothetical protein MLP_43590 ... 46.6 0.001 gi|326331751|ref|ZP_08198039.1| conserved domain protein [Nocard... 44.3 0.007 gi|315446123|ref|YP_004079002.1| hypothetical protein Mspyr1_461... 41.6 0.044 gi|182626864|ref|ZP_02954600.1| conserved hypothetical protein [... 40.8 0.077 gi|333989974|ref|YP_004522588.1| hypothetical protein JDM601_133... 37.7 0.62 gi|191637418|ref|YP_001986584.1| hypothetical protein LCABL_0601... 36.6 1.4 gi|134102275|ref|YP_001107936.1| hypothetical protein SACE_5827 ... 36.2 1.9 gi|168206955|ref|ZP_02632960.1| conserved hypothetical protein [... 35.8 2.5 gi|168210941|ref|ZP_02636566.1| conserved hypothetical protein [... 35.4 2.9 gi|169344684|ref|ZP_02865649.1| conserved hypothetical protein [... 35.0 3.5 gi|187935826|ref|YP_001893636.1| hypothetical protein CLL_0013 [... 35.0 3.7 gi|320102226|ref|YP_004177817.1| phosphoenolpyruvate-protein pho... 35.0 3.8 gi|15081521|ref|NP_150034.1| hypothetical protein PCP41 [Clostri... 34.7 4.4 gi|209547376|ref|YP_002279294.1| hypothetical protein Rleg2_5374... 34.7 4.5 gi|182624935|ref|ZP_02952714.1| conserved hypothetical protein [... 34.3 6.2 gi|322433128|ref|YP_004210377.1| transcriptional regulator, CopG... 34.3 6.7 gi|239629277|ref|ZP_04672308.1| conserved hypothetical protein [... 33.9 7.6 >gi|339293356|gb|AEJ45467.1| hypothetical protein CCDC5079_0277 [Mycobacterium tuberculosis CCDC5079] Length=190 Score = 140 bits (352), Expect = 8e-32, Method: Compositional matrix adjust. Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA Sbjct 118 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 177 Query 61 GLGDPELMRQAWR 73 GLGDPELMRQAWR Sbjct 178 GLGDPELMRQAWR 190 >gi|15607441|ref|NP_214814.1| hypothetical protein Rv0300 [Mycobacterium tuberculosis H37Rv] gi|31791479|ref|NP_853972.1| hypothetical protein Mb0308 [Mycobacterium bovis AF2122/97] gi|121636215|ref|YP_976438.1| hypothetical protein BCG_0340 [Mycobacterium bovis BCG str. Pasteur 1173P2] 64 more sequence titles Length=73 Score = 138 bits (348), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA Sbjct 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 Query 61 GLGDPELMRQAWR 73 GLGDPELMRQAWR Sbjct 61 GLGDPELMRQAWR 73 >gi|306774397|ref|ZP_07412734.1| antitoxin [Mycobacterium tuberculosis SUMu001] gi|308216989|gb|EFO76388.1| antitoxin [Mycobacterium tuberculosis SUMu001] Length=73 Score = 137 bits (344), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 72/73 (99%), Positives = 72/73 (99%), Gaps = 0/73 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQD QTARVTVTAADLRRLRGAVA Sbjct 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDGQTARVTVTAADLRRLRGAVA 60 Query 61 GLGDPELMRQAWR 73 GLGDPELMRQAWR Sbjct 61 GLGDPELMRQAWR 73 >gi|284034115|ref|YP_003384046.1| hypothetical protein Kfla_6244 [Kribbella flavida DSM 17836] gi|283813408|gb|ADB35247.1| hypothetical protein Kfla_6244 [Kribbella flavida DSM 17836] Length=73 Score = 90.9 bits (224), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 47/72 (66%), Positives = 57/72 (80%), Gaps = 0/72 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 MSDVLIRD+PDDVLA LD+ A LGLSR EY+RRRL+Q+A+ + TVTAA LRRL A+ Sbjct 1 MSDVLIRDVPDDVLAVLDSRARHLGLSRNEYLRRRLSQEAKRSGETVTAAHLRRLSHAIR 60 Query 61 GLGDPELMRQAW 72 L DP++M QAW Sbjct 61 DLDDPDVMDQAW 72 >gi|297564352|ref|YP_003683325.1| hypothetical protein Ndas_5440 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296848801|gb|ADH70819.1| conserved hypothetical protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length=73 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 34/72 (48%), Positives = 46/72 (64%), Gaps = 0/72 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 M+DVLIR++P+ VL +DA A R GLSR EY+RR L + A + VT L R A + Sbjct 1 MADVLIRNVPEGVLEVIDADARRQGLSRGEYLRRLLERTAHPSGGAVTVDGLARFSEAFS 60 Query 61 GLGDPELMRQAW 72 L DP +M++AW Sbjct 61 DLADPAVMKRAW 72 >gi|296128791|ref|YP_003636041.1| hypothetical protein Cfla_0934 [Cellulomonas flavigena DSM 20109] gi|296020606|gb|ADG73842.1| conserved hypothetical protein [Cellulomonas flavigena DSM 20109] Length=75 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQD--AQTARVTVTAADLRRLRGA 58 M D+L+R + + +A DA AA LGLSR E +RR L + A R T+T D R Sbjct 1 MPDILVRGLSEAAVAHFDAEAASLGLSRAEVLRRHLEAEVRADAPRPTMTPDDWDRFARE 60 Query 59 VAGLGDPELMRQAWR 73 LGDPE+M AWR Sbjct 61 FGDLGDPEVMASAWR 75 >gi|336117847|ref|YP_004572615.1| hypothetical protein MLP_21980 [Microlunatus phosphovorus NM-1] gi|334685627|dbj|BAK35212.1| hypothetical protein MLP_21980 [Microlunatus phosphovorus NM-1] Length=74 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 32/73 (44%), Positives = 47/73 (65%), Gaps = 1/73 (1%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDA-QTARVTVTAADLRRLRGAV 59 M+DVLIR++ D+ L +DA+AA GLSR E +RR + A + A VT DL+++ Sbjct 1 MTDVLIRNVDDEDLERIDALAAGQGLSRNELLRRETHEIARRHALSQVTLDDLQQVAELA 60 Query 60 AGLGDPELMRQAW 72 G+ D +LMR+AW Sbjct 61 KGVLDEDLMRRAW 73 >gi|336119998|ref|YP_004574776.1| hypothetical protein MLP_43590 [Microlunatus phosphovorus NM-1] gi|334687788|dbj|BAK37373.1| hypothetical protein MLP_43590 [Microlunatus phosphovorus NM-1] Length=60 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 0/57 (0%) Query 17 LDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR 73 +DA A+ LGLSR E++RR+L D+ + T T + RR A L DP +M AWR Sbjct 4 IDAEASALGLSRNEFLRRKLEGDSPRSGETTTDENWRRAGEIFADLADPAVMADAWR 60 >gi|326331751|ref|ZP_08198039.1| conserved domain protein [Nocardioidaceae bacterium Broad-1] gi|325950550|gb|EGD42602.1| conserved domain protein [Nocardioidaceae bacterium Broad-1] Length=72 Score = 44.3 bits (103), Expect = 0.007, Method: Compositional matrix adjust. Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDA 40 MSDVLIR + DD LA +D A RLGL+R +Y+RR DA Sbjct 1 MSDVLIRGLSDDELARIDTEATRLGLTRDDYLRRWFTPDA 40 >gi|315446123|ref|YP_004079002.1| hypothetical protein Mspyr1_46170 [Mycobacterium sp. Spyr1] gi|315264426|gb|ADU01168.1| hypothetical protein Mspyr1_46170 [Mycobacterium sp. Spyr1] Length=75 Score = 41.6 bits (96), Expect = 0.044, Method: Compositional matrix adjust. Identities = 34/77 (45%), Positives = 45/77 (59%), Gaps = 6/77 (7%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVT----VTAADLRRLR 56 M+DVLIR + + +A +DA AA GLSR EY+RRR +A+ R +T DLRR Sbjct 1 MADVLIRGLSEAAVAHIDAAAAAQGLSRQEYLRRRF--EAERPRSDSGGRLTIDDLRRAS 58 Query 57 GAVAGLGDPELMRQAWR 73 A + L +PE M AW Sbjct 59 AAASDLDNPEAMDGAWH 75 >gi|182626864|ref|ZP_02954600.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] gi|182626887|ref|ZP_02954622.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] gi|182627090|ref|ZP_02954811.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] 7 more sequence titles Length=97 Score = 40.8 bits (94), Expect = 0.077, Method: Compositional matrix adjust. Identities = 20/63 (32%), Positives = 38/63 (61%), Gaps = 8/63 (12%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGL-SRTEYIRRRLAQDAQTARVTVTAADLRRLRGAV 59 MSD+LIRD+P+D++ LD + + G SR ++++R+L + + +L+R+ G Sbjct 1 MSDILIRDVPEDIVFKLDELVKKSGAKSRNDFLKRQL-------ELMSSLEELKRIEGNY 53 Query 60 AGL 62 + L Sbjct 54 SYL 56 >gi|333989974|ref|YP_004522588.1| hypothetical protein JDM601_1334 [Mycobacterium sp. JDM601] gi|333485942|gb|AEF35334.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=80 Score = 37.7 bits (86), Expect = 0.62, Method: Compositional matrix adjust. Identities = 31/66 (47%), Positives = 41/66 (63%), Gaps = 2/66 (3%) Query 1 MSDVL-IRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVT-VTAADLRRLRGA 58 MS V+ IRD+PD+V A+L AA GLS T Y++R L A+ A+V AA +RR + A Sbjct 1 MSKVMHIRDVPDEVHAALVEAAAAQGLSLTRYLQRELEHLAKRAQVVRHNAAVIRRTQRA 60 Query 59 VAGLGD 64 V G D Sbjct 61 VEGRAD 66 >gi|191637418|ref|YP_001986584.1| hypothetical protein LCABL_06010 [lactobacillus casei BL23] gi|190711720|emb|CAQ65726.1| Putative uncharacterized protein [Lactobacillus casei BL23] gi|327381463|gb|AEA52939.1| hypothetical protein LC2W_0605 [Lactobacillus casei LC2W] gi|327384631|gb|AEA56105.1| hypothetical protein LCBD_0607 [Lactobacillus casei BD-II] Length=85 Score = 36.6 bits (83), Expect = 1.4, Method: Compositional matrix adjust. Identities = 21/57 (37%), Positives = 32/57 (57%), Gaps = 0/57 (0%) Query 4 VLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA 60 +IR++ + LA+LD A R LSR EY+R + DA ++ +DLR L +A Sbjct 8 TIIRNLSEQDLAALDDAAKRSHLSREEYLRMLIHHDATNHLLSGDVSDLRELTKQMA 64 >gi|134102275|ref|YP_001107936.1| hypothetical protein SACE_5827 [Saccharopolyspora erythraea NRRL 2338] gi|291003762|ref|ZP_06561735.1| hypothetical protein SeryN2_04502 [Saccharopolyspora erythraea NRRL 2338] gi|133914898|emb|CAM05011.1| hypothetical protein SACE_5827 [Saccharopolyspora erythraea NRRL 2338] Length=76 Score = 36.2 bits (82), Expect = 1.9, Method: Compositional matrix adjust. Identities = 26/71 (37%), Positives = 34/71 (48%), Gaps = 16/71 (22%) Query 4 VLIRDIPDDVLASLDAIAARLGLSRTEYIR----------------RRLAQDAQTARVTV 47 V IRD+P+DV +L A G S +E++R RRL Q Q + Sbjct 5 VQIRDVPEDVYRTLKIRAVEAGQSYSEFLRGLLTQAASRPPMAEMVRRLEQRGQLTDLDS 64 Query 48 TAADLRRLRGA 58 TAAD+R LR A Sbjct 65 TAADVRELRDA 75 >gi|168206955|ref|ZP_02632960.1| conserved hypothetical protein [Clostridium perfringens E str. JGS1987] gi|170661642|gb|EDT14325.1| conserved hypothetical protein [Clostridium perfringens E str. JGS1987] Length=91 Score = 35.8 bits (81), Expect = 2.5, Method: Compositional matrix adjust. Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 0/37 (0%) Query 2 SDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQ 38 S++ IR + DV+A LD IA G+SR E+++ L + Sbjct 4 SEIKIRGLSKDVIAKLDFIAKEKGISRNEFLKENLEK 40 >gi|168210941|ref|ZP_02636566.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC 3626] gi|170710985|gb|EDT23167.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC 3626] Length=91 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 0/37 (0%) Query 2 SDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQ 38 S++ IR + DV+A LD IA G+SR E+++ L + Sbjct 4 SEIKIRGLSKDVIAKLDFIAKEKGISRNEFLKENLEK 40 >gi|169344684|ref|ZP_02865649.1| conserved hypothetical protein [Clostridium perfringens C str. JGS1495] gi|169297294|gb|EDS79406.1| conserved hypothetical protein [Clostridium perfringens C str. JGS1495] Length=88 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 15/53 (29%), Positives = 30/53 (57%), Gaps = 0/53 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLR 53 MSD+L+RD+ + + +D+ A G+SR E+++ L + + + A+ R Sbjct 1 MSDLLVRDLSKEAITRIDSFAKAKGVSRNEFLKEHLESLSHSDEMRKFEANYR 53 >gi|187935826|ref|YP_001893636.1| hypothetical protein CLL_0013 [Clostridium botulinum B str. Eklund 17B] gi|187723978|gb|ACD14184.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund 17B] Length=91 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 13/36 (37%), Positives = 23/36 (64%), Gaps = 0/36 (0%) Query 3 DVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQ 38 ++ +RDI + + +D +A + GLSR EY++R L Sbjct 2 EIKVRDISKEAVIKIDGLAKKKGLSRNEYLKRHLEN 37 >gi|320102226|ref|YP_004177817.1| phosphoenolpyruvate-protein phosphotransferase [Isosphaera pallida ATCC 43644] gi|319749508|gb|ADV61268.1| phosphoenolpyruvate-protein phosphotransferase [Isosphaera pallida ATCC 43644] Length=617 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 16/59 (27%) Query 10 PDDVLASLDAIAARLGLSRTEYI----------------RRRLAQDAQTARVTVTAADL 52 PDDV+A+L A A +GL RTEY+ RR+ ++AQ VT+ A DL Sbjct 313 PDDVIAALRAGAGGVGLFRTEYLFLAHHDFPDEDEQYEHYRRVVENAQGKPVTIRALDL 371 >gi|15081521|ref|NP_150034.1| hypothetical protein PCP41 [Clostridium perfringens str. 13] gi|15076754|dbj|BAB62479.1| hypothetical protein [Clostridium perfringens str. 13] Length=88 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 13/36 (37%), Positives = 24/36 (67%), Gaps = 0/36 (0%) Query 1 MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRL 36 MSD+L+RD+ + + +D+ A G+SR E+++ L Sbjct 1 MSDLLVRDLSKEAITRIDSFAKAKGVSRNEFLKEHL 36 >gi|209547376|ref|YP_002279294.1| hypothetical protein Rleg2_5374 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209538620|gb|ACI58554.1| Protein of unknown function DUF1778 [Rhizobium leguminosarum bv. trifolii WSM2304] Length=94 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 0/33 (0%) Query 11 DDVLASLDAIAARLGLSRTEYIRRRLAQDAQTA 43 DD LA +D AA GLSRTE++RR +AQTA Sbjct 18 DDDLAIIDRGAALTGLSRTEFMRRAAVHEAQTA 50 >gi|182624935|ref|ZP_02952714.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] gi|177909941|gb|EDT72351.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] Length=91 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 17/52 (33%), Positives = 30/52 (58%), Gaps = 0/52 (0%) Query 2 SDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLR 53 S++ IR + +V+A LDAIA G+SR E+++ + + A + AD + Sbjct 4 SEIKIRGLKKEVIAKLDAIAEEKGISRNEFLKDNIEKLAVLNEMKKFEADYK 55 >gi|322433128|ref|YP_004210377.1| transcriptional regulator, CopG family [Acidobacterium sp. MP5ACTX9] gi|321165355|gb|ADW71059.1| putative transcriptional regulator, CopG family [Acidobacterium sp. MP5ACTX9] Length=71 Score = 34.3 bits (77), Expect = 6.7, Method: Compositional matrix adjust. Identities = 13/39 (34%), Positives = 26/39 (67%), Gaps = 0/39 (0%) Query 8 DIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVT 46 DIP++ +A++ + LG+SR E++RR ++Q + R + Sbjct 6 DIPEEDIAAIKQVTVALGISRAEFVRRAVSQSLEPYRTS 44 >gi|239629277|ref|ZP_04672308.1| conserved hypothetical protein [Lactobacillus paracasei subsp. paracasei 8700:2] gi|239528482|gb|EEQ67483.1| conserved hypothetical protein [Lactobacillus paracasei subsp. paracasei 8700:2] Length=87 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 20/52 (39%), Positives = 30/52 (58%), Gaps = 0/52 (0%) Query 4 VLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRL 55 +IR++ + LA+LD A R LSR EY+R + DA ++ +DLR L Sbjct 5 TIIRNLSEQDLAALDDAAKRSRLSREEYLRELIHHDATDHLLSGDVSDLREL 56 Lambda K H 0.324 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131942442484 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40