BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0660c Length=81 Score E Sequences producing significant alignments: (Bits) Value gi|15840063|ref|NP_335100.1| hypothetical protein MT0689 [Mycoba... 154 5e-36 gi|15607800|ref|NP_215174.1| hypothetical protein Rv0660c [Mycob... 153 7e-36 >gi|15840063|ref|NP_335100.1| hypothetical protein MT0689 [Mycobacterium tuberculosis CDC1551] gi|167967494|ref|ZP_02549771.1| hypothetical protein MtubH3_05442 [Mycobacterium tuberculosis H37Ra] gi|254230988|ref|ZP_04924315.1| conserved hypothetical protein [Mycobacterium tuberculosis C] 24 more sequence titlesLength=83 Score = 154 bits (388), Expect = 5e-36, Method: Compositional matrix adjust. Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%) Query 1 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA 60 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA Sbjct 3 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA 62 Query 61 LAEIADWGPAEDWADWADAAR 81 LAEIADWGPAEDWADWADAAR Sbjct 63 LAEIADWGPAEDWADWADAAR 83 >gi|15607800|ref|NP_215174.1| hypothetical protein Rv0660c [Mycobacterium tuberculosis H37Rv] gi|31791844|ref|NP_854337.1| hypothetical protein Mb0679c [Mycobacterium bovis AF2122/97] gi|121636581|ref|YP_976804.1| hypothetical protein BCG_0709c [Mycobacterium bovis BCG str. Pasteur 1173P2] 50 more sequence titles Length=81 Score = 153 bits (387), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%) Query 1 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA 60 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA Sbjct 1 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA 60 Query 61 LAEIADWGPAEDWADWADAAR 81 LAEIADWGPAEDWADWADAAR Sbjct 61 LAEIADWGPAEDWADWADAAR 81 Lambda K H 0.320 0.132 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128409240708 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40