BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0664 Length=90 Score E Sequences producing significant alignments: (Bits) Value gi|15607804|ref|NP_215178.1| hypothetical protein Rv0664 [Mycoba... 175 2e-42 gi|340625682|ref|YP_004744134.1| hypothetical protein MCAN_06631... 173 8e-42 gi|150864085|ref|XP_001382781.2| filamentous growth, cell polari... 35.0 3.3 >gi|15607804|ref|NP_215178.1| hypothetical protein Rv0664 [Mycobacterium tuberculosis H37Rv] gi|31791848|ref|NP_854341.1| hypothetical protein Mb0683 [Mycobacterium bovis AF2122/97] gi|121636585|ref|YP_976808.1| hypothetical protein BCG_0713 [Mycobacterium bovis BCG str. Pasteur 1173P2] 56 more sequence titlesLength=90 Score = 175 bits (444), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 90/90 (100%), Positives = 90/90 (100%), Gaps = 0/90 (0%) Query 1 MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGA 60 MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGA Sbjct 1 MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGA 60 Query 61 HLRDELAKRSADPRLTDELNDLAGHTLDDL 90 HLRDELAKRSADPRLTDELNDLAGHTLDDL Sbjct 61 HLRDELAKRSADPRLTDELNDLAGHTLDDL 90 >gi|340625682|ref|YP_004744134.1| hypothetical protein MCAN_06631 [Mycobacterium canettii CIPT 140010059] gi|340003872|emb|CCC43003.1| hypothetical protein MCAN_06631 [Mycobacterium canettii CIPT 140010059] Length=90 Score = 173 bits (438), Expect = 8e-42, Method: Compositional matrix adjust. Identities = 89/90 (99%), Positives = 89/90 (99%), Gaps = 0/90 (0%) Query 1 MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGA 60 MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGT GAGRRYRAASAPHPLAVGA Sbjct 1 MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTWGAGRRYRAASAPHPLAVGA 60 Query 61 HLRDELAKRSADPRLTDELNDLAGHTLDDL 90 HLRDELAKRSADPRLTDELNDLAGHTLDDL Sbjct 61 HLRDELAKRSADPRLTDELNDLAGHTLDDL 90 >gi|150864085|ref|XP_001382781.2| filamentous growth, cell polarity and elongation [Scheffersomyces stipitis CBS 6054] gi|149385341|gb|ABN64752.2| filamentous growth, cell polarity and elongation [Scheffersomyces stipitis CBS 6054] Length=457 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 23/71 (33%), Positives = 32/71 (46%), Gaps = 5/71 (7%) Query 14 GCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGAHLRDELAKRSADP 73 G A S G CG +G+ G G G + A + L V +E KRSADP Sbjct 350 GAAASCSGGADGITCGMNWASGNWDGIYGLGEQTSALEVMNALIV-----EEPLKRSADP 404 Query 74 RLTDELNDLAG 84 + D+++ AG Sbjct 405 EVADKIDYNAG 415 Lambda K H 0.315 0.133 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 129182109240 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40