BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0666 Length=57 Score E Sequences producing significant alignments: (Bits) Value gi|15607806|ref|NP_215180.1| hypothetical protein Rv0666 [Mycoba... 110 5e-23 gi|340625684|ref|YP_004744136.1| hypothetical protein MCAN_06651... 90.5 7e-17 >gi|15607806|ref|NP_215180.1| hypothetical protein Rv0666 [Mycobacterium tuberculosis H37Rv] gi|31791850|ref|NP_854343.1| hypothetical protein Mb0685 [Mycobacterium bovis AF2122/97] gi|121636587|ref|YP_976810.1| hypothetical protein BCG_0715 [Mycobacterium bovis BCG str. Pasteur 1173P2] 52 more sequence titlesLength=57 Score = 110 bits (276), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 56/57 (99%), Positives = 57/57 (100%), Gaps = 0/57 (0%) Query 1 VTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD 57 +TPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD Sbjct 1 MTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD 57 >gi|340625684|ref|YP_004744136.1| hypothetical protein MCAN_06651 [Mycobacterium canettii CIPT 140010059] gi|340003874|emb|CCC43005.1| putative membrane protein [Mycobacterium canettii CIPT 140010059] Length=57 Score = 90.5 bits (223), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 54/57 (95%), Positives = 56/57 (99%), Gaps = 0/57 (0%) Query 1 VTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD 57 +TPRT+EGAAAPCLMPDVTMPVKR DARGALGVGPALFVVSVSSSLVRARSCRCTAD Sbjct 1 MTPRTEEGAAAPCLMPDVTMPVKRDDARGALGVGPALFVVSVSSSLVRARSCRCTAD 57 Lambda K H 0.321 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128599645896 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40