BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0699 Length=73 Score E Sequences producing significant alignments: (Bits) Value gi|15607839|ref|NP_215213.1| hypothetical protein Rv0699 [Mycoba... 139 2e-31 gi|294996193|ref|ZP_06801884.1| hypothetical protein Mtub2_17241... 136 1e-30 >gi|15607839|ref|NP_215213.1| hypothetical protein Rv0699 [Mycobacterium tuberculosis H37Rv] gi|31791884|ref|NP_854377.1| hypothetical protein Mb0719 [Mycobacterium bovis AF2122/97] gi|121636621|ref|YP_976844.1| hypothetical protein BCG_0749 [Mycobacterium bovis BCG str. Pasteur 1173P2] 18 more sequence titlesLength=73 Score = 139 bits (349), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%) Query 1 MGDRRVDLLAAKDSEIRRSMGAVPVGAGSSQVATSWASDRCIRCRAAILSADCANLARAN 60 MGDRRVDLLAAKDSEIRRSMGAVPVGAGSSQVATSWASDRCIRCRAAILSADCANLARAN Sbjct 1 MGDRRVDLLAAKDSEIRRSMGAVPVGAGSSQVATSWASDRCIRCRAAILSADCANLARAN 60 Query 61 SRGGLAVGGSAVS 73 SRGGLAVGGSAVS Sbjct 61 SRGGLAVGGSAVS 73 >gi|294996193|ref|ZP_06801884.1| hypothetical protein Mtub2_17241 [Mycobacterium tuberculosis 210] gi|326905079|gb|EGE52012.1| hypothetical protein TBPG_03006 [Mycobacterium tuberculosis W-148] Length=73 Score = 136 bits (342), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 72/73 (99%), Positives = 72/73 (99%), Gaps = 0/73 (0%) Query 1 MGDRRVDLLAAKDSEIRRSMGAVPVGAGSSQVATSWASDRCIRCRAAILSADCANLARAN 60 MGDRRVDLLAAK SEIRRSMGAVPVGAGSSQVATSWASDRCIRCRAAILSADCANLARAN Sbjct 1 MGDRRVDLLAAKGSEIRRSMGAVPVGAGSSQVATSWASDRCIRCRAAILSADCANLARAN 60 Query 61 SRGGLAVGGSAVS 73 SRGGLAVGGSAVS Sbjct 61 SRGGLAVGGSAVS 73 Lambda K H 0.318 0.128 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131942442484 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40