BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv0942 Length=92 Score E Sequences producing significant alignments: (Bits) Value gi|15608082|ref|NP_215457.1| hypothetical protein Rv0942 [Mycoba... 186 1e-45 >gi|15608082|ref|NP_215457.1| hypothetical protein Rv0942 [Mycobacterium tuberculosis H37Rv] gi|31792131|ref|NP_854624.1| hypothetical protein Mb0967 [Mycobacterium bovis AF2122/97] gi|121636867|ref|YP_977090.1| hypothetical protein BCG_0996 [Mycobacterium bovis BCG str. Pasteur 1173P2] 29 more sequence titlesLength=92 Score = 186 bits (472), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%) Query 1 LGRSATIAMVPKRRDAMNRHSGPILSSGFIASSSNSCPANSLRMPSALAAETLSFDDRAV 60 +GRSATIAMVPKRRDAMNRHSGPILSSGFIASSSNSCPANSLRMPSALAAETLSFDDRAV Sbjct 1 MGRSATIAMVPKRRDAMNRHSGPILSSGFIASSSNSCPANSLRMPSALAAETLSFDDRAV 60 Query 61 RRSTHHPGGGYPQKHAINLQSGLCPAYANASR 92 RRSTHHPGGGYPQKHAINLQSGLCPAYANASR Sbjct 61 RRSTHHPGGGYPQKHAINLQSGLCPAYANASR 92 Lambda K H 0.316 0.127 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128268350160 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40