BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1028A Length=30 Score E Sequences producing significant alignments: (Bits) Value gi|50953769|ref|YP_061208.1| hypothetical protein MT1057.1 [Myco... 58.2 4e-07 gi|31792220|ref|NP_854713.1| membrane protein kdpF [Mycobacteriu... 58.2 4e-07 gi|117164413|emb|CAJ87958.1| putative small membrane protein [St... 40.0 0.11 gi|289770673|ref|ZP_06530051.1| predicted protein [Streptomyces ... 39.3 0.17 gi|254386379|ref|ZP_05001685.1| hypothetical protein SSAG_06012 ... 39.3 0.17 gi|291454272|ref|ZP_06593662.1| predicted protein [Streptomyces ... 39.3 0.18 gi|120405708|ref|YP_955537.1| hypothetical protein Mvan_4758 [My... 38.9 0.23 gi|294633098|ref|ZP_06711657.1| K+-transporting ATPase, F subuni... 38.1 0.47 gi|21222132|ref|NP_627911.1| small membrane protein [Streptomyce... 37.0 0.96 gi|118472067|ref|YP_889632.1| hypothetical protein MSMEG_5391 [M... 36.6 1.3 gi|254380489|ref|ZP_04995855.1| hypothetical protein SSAG_00157 ... 35.4 3.2 >gi|50953769|ref|YP_061208.1| hypothetical protein MT1057.1 [Mycobacterium tuberculosis CDC1551] gi|167968529|ref|ZP_02550806.1| hypothetical protein MtubH3_11036 [Mycobacterium tuberculosis H37Ra] gi|254550014|ref|ZP_05140461.1| hypothetical protein Mtube_06073 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] 13 more sequence titlesLength=32 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%) Query 1 MTTVDNIVGLVIAVALMAFLFAALLFPEKF 30 MTTVDNIVGLVIAVALMAFLFAALLFPEKF Sbjct 3 MTTVDNIVGLVIAVALMAFLFAALLFPEKF 32 >gi|31792220|ref|NP_854713.1| membrane protein kdpF [Mycobacterium bovis AF2122/97] gi|57116812|ref|YP_177636.1| membrane protein kdpF [Mycobacterium tuberculosis H37Rv] gi|121636958|ref|YP_977181.1| putative membrane protein kdpF [Mycobacterium bovis BCG str. Pasteur 1173P2] 50 more sequence titles Length=30 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%) Query 1 MTTVDNIVGLVIAVALMAFLFAALLFPEKF 30 MTTVDNIVGLVIAVALMAFLFAALLFPEKF Sbjct 1 MTTVDNIVGLVIAVALMAFLFAALLFPEKF 30 >gi|117164413|emb|CAJ87958.1| putative small membrane protein [Streptomyces ambofaciens ATCC 23877] Length=29 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/28 (58%), Positives = 25/28 (90%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 TV+NIVGL++AV+L+ +L AL++PE+F Sbjct 2 TVENIVGLIVAVSLLGYLALALIYPERF 29 >gi|289770673|ref|ZP_06530051.1| predicted protein [Streptomyces lividans TK24] gi|289700872|gb|EFD68301.1| predicted protein [Streptomyces lividans TK24] Length=94 Score = 39.3 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 15/28 (54%), Positives = 23/28 (83%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 T +N+VGL++AVAL+ +L AL+ PE+F Sbjct 67 TAENVVGLIVAVALLGYLVLALIHPERF 94 >gi|254386379|ref|ZP_05001685.1| hypothetical protein SSAG_06012 [Streptomyces sp. Mg1] gi|194345230|gb|EDX26196.1| hypothetical protein SSAG_06012 [Streptomyces sp. Mg1] Length=74 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 13/28 (47%), Positives = 25/28 (90%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 +++NI+GL++AV+L+ +L AL++PE+F Sbjct 47 SIENIIGLLVAVSLLGYLILALVYPERF 74 >gi|291454272|ref|ZP_06593662.1| predicted protein [Streptomyces albus J1074] gi|291357221|gb|EFE84123.1| predicted protein [Streptomyces albus J1074] Length=86 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 18/28 (65%), Positives = 23/28 (83%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 TV+NIVGLV+A AL+ +L ALLFP +F Sbjct 59 TVENIVGLVVAAALVGYLVLALLFPGRF 86 >gi|120405708|ref|YP_955537.1| hypothetical protein Mvan_4758 [Mycobacterium vanbaalenii PYR-1] gi|119958526|gb|ABM15531.1| hypothetical protein Mvan_4758 [Mycobacterium vanbaalenii PYR-1] Length=96 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 15/29 (52%), Positives = 21/29 (73%), Gaps = 0/29 (0%) Query 2 TTVDNIVGLVIAVALMAFLFAALLFPEKF 30 + N++GL +A + FLFAALLFPE+F Sbjct 68 SVTQNLIGLALAALIAVFLFAALLFPERF 96 >gi|294633098|ref|ZP_06711657.1| K+-transporting ATPase, F subunit [Streptomyces sp. e14] gi|292830879|gb|EFF89229.1| K+-transporting ATPase, F subunit [Streptomyces sp. e14] Length=75 Score = 38.1 bits (87), Expect = 0.47, Method: Compositional matrix adjust. Identities = 16/28 (58%), Positives = 22/28 (79%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 T +N VGL+ AVAL+ +L AL+FPE+F Sbjct 48 TAENTVGLIAAVALLGYLVLALIFPERF 75 >gi|21222132|ref|NP_627911.1| small membrane protein [Streptomyces coelicolor A3(2)] gi|5019369|emb|CAB44422.1| putative small membrane protein [Streptomyces coelicolor A3(2)] Length=29 Score = 37.0 bits (84), Expect = 0.96, Method: Compositional matrix adjust. Identities = 15/28 (54%), Positives = 23/28 (83%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 T +N+VGL++AVAL+ +L AL+ PE+F Sbjct 2 TAENVVGLIVAVALLGYLVLALIRPERF 29 >gi|118472067|ref|YP_889632.1| hypothetical protein MSMEG_5391 [Mycobacterium smegmatis str. MC2 155] gi|118173354|gb|ABK74250.1| hypothetical protein MSMEG_5391 [Mycobacterium smegmatis str. MC2 155] Length=69 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/27 (56%), Positives = 23/27 (86%), Gaps = 0/27 (0%) Query 4 VDNIVGLVIAVALMAFLFAALLFPEKF 30 ++N+VGL++AV + F+ AALLFPE+F Sbjct 43 IENVVGLILAVLIAVFIGAALLFPERF 69 >gi|254380489|ref|ZP_04995855.1| hypothetical protein SSAG_00157 [Streptomyces sp. Mg1] gi|194339400|gb|EDX20366.1| hypothetical protein SSAG_00157 [Streptomyces sp. Mg1] Length=36 Score = 35.4 bits (80), Expect = 3.2, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%) Query 3 TVDNIVGLVIAVALMAFLFAALLFPEKF 30 + + IVG+++AV+L+ +L AL FPEKF Sbjct 9 STETIVGIIVAVSLVGYLVLALFFPEKF 36 Lambda K H 0.339 0.148 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128592069950 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40