BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1053c Length=91 Score E Sequences producing significant alignments: (Bits) Value gi|15608193|ref|NP_215569.1| hypothetical protein Rv1053c [Mycob... 191 2e-47 gi|288928980|ref|ZP_06422826.1| conserved hypothetical protein [... 36.2 1.8 gi|326664453|ref|XP_001919791.3| PREDICTED: b-cell receptor CD22... 35.8 2.0 gi|292610151|ref|XP_001344809.3| PREDICTED: b-cell receptor CD22... 34.7 5.4 >gi|15608193|ref|NP_215569.1| hypothetical protein Rv1053c [Mycobacterium tuberculosis H37Rv] gi|31792244|ref|NP_854737.1| hypothetical protein Mb1082c [Mycobacterium bovis AF2122/97] gi|121636982|ref|YP_977205.1| hypothetical protein BCG_1111c [Mycobacterium bovis BCG str. Pasteur 1173P2] 38 more sequence titlesLength=91 Score = 191 bits (486), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 91/91 (100%), Positives = 91/91 (100%), Gaps = 0/91 (0%) Query 1 MDSHKVCMNNNTQLPTGPIIGVHPAVRDGVERVAYLDGDLLRCNTDVEFTSSPPPGPVLY 60 MDSHKVCMNNNTQLPTGPIIGVHPAVRDGVERVAYLDGDLLRCNTDVEFTSSPPPGPVLY Sbjct 1 MDSHKVCMNNNTQLPTGPIIGVHPAVRDGVERVAYLDGDLLRCNTDVEFTSSPPPGPVLY 60 Query 61 RTKHTRVEIADEMVTEKLIKRQRAFNSRRHQ 91 RTKHTRVEIADEMVTEKLIKRQRAFNSRRHQ Sbjct 61 RTKHTRVEIADEMVTEKLIKRQRAFNSRRHQ 91 >gi|288928980|ref|ZP_06422826.1| conserved hypothetical protein [Prevotella sp. oral taxon 317 str. F0108] gi|288329964|gb|EFC68549.1| conserved hypothetical protein [Prevotella sp. oral taxon 317 str. F0108] Length=394 Score = 36.2 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 30/83 (37%), Positives = 41/83 (50%), Gaps = 9/83 (10%) Query 15 PTGPIIGVHPAVRDGVERVAYLDGDLLRCNTDV-EFTSSPPPGPVLY---RTKHTRVEIA 70 P G I + + + VERV+ +GD LR ++ F +S P G + Y R+K +IA Sbjct 63 PNGEISVITAPMTETVERVSAKEGDKLRKGDEILRFRTSSPDGKITYQQERSKEASAQIA 122 Query 71 DEMVTEKLIKRQ--RAFNSRRHQ 91 D E L K Q RAF S Q Sbjct 123 D---LELLSKGQCPRAFASAARQ 142 >gi|326664453|ref|XP_001919791.3| PREDICTED: b-cell receptor CD22-like [Danio rerio] Length=487 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 27/80 (34%), Positives = 33/80 (42%), Gaps = 11/80 (13%) Query 2 DSHKVCMNNNTQLPTGPIIGVHPAVRDGV--------ERVAYLDGDLLRCNTDVEFTSSP 53 D H NT + G G+ P VR V ERV D L CN+ E T +P Sbjct 107 DEHDYFFKFNTNVTKGRWTGI-PGVRLSVTDLQLESPERVTEGDSVRLTCNSSCELTDTP 165 Query 54 PPGPVLYRTKHTRVEIADEM 73 + YR HT I DE+ Sbjct 166 TF--IWYRNSHTLTNIGDEL 183 >gi|292610151|ref|XP_001344809.3| PREDICTED: b-cell receptor CD22-like [Danio rerio] Length=510 Score = 34.7 bits (78), Expect = 5.4, Method: Compositional matrix adjust. Identities = 26/89 (30%), Positives = 36/89 (41%), Gaps = 11/89 (12%) Query 2 DSHKVCMNNNTQLPTGPIIGVHPAVRDGV--------ERVAYLDGDLLRCNTDVEFTSSP 53 D H T + G +IG+ P VR V ERV D L C + T +P Sbjct 108 DEHDYYFRFTTNVTFGKVIGI-PGVRLSVTDLQLESPERVTEGDSVRLTCRSSCNLTDTP 166 Query 54 PPGPVLYRTKHTRVEIADEMVTEKLIKRQ 82 + YR HT I DE+ + +R+ Sbjct 167 TF--IWYRNSHTLTNIGDELNIRSVSRRE 193 Lambda K H 0.319 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128725229700 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40