BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1116 Length=61 Score E Sequences producing significant alignments: (Bits) Value gi|15840553|ref|NP_335590.1| hypothetical protein MT1147 [Mycoba... 123 9e-27 gi|15608256|ref|NP_215632.1| hypothetical protein Rv1116 [Mycoba... 123 1e-26 >gi|15840553|ref|NP_335590.1| hypothetical protein MT1147 [Mycobacterium tuberculosis CDC1551] gi|167969251|ref|ZP_02551528.1| hypothetical protein MtubH3_14975 [Mycobacterium tuberculosis H37Ra] gi|289555097|ref|ZP_06444307.1| hypothetical protein TBXG_02847 [Mycobacterium tuberculosis KZN 605] gi|289744859|ref|ZP_06504237.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] gi|13880731|gb|AAK45404.1| hypothetical protein MT1147 [Mycobacterium tuberculosis CDC1551] gi|289439729|gb|EFD22222.1| hypothetical protein TBXG_02847 [Mycobacterium tuberculosis KZN 605] gi|289685387|gb|EFD52875.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] Length=77 Score = 123 bits (309), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%) Query 1 MCSRMADEPRLEAGAHPFEEGRDKAPELRATQMDHVRFTEGRRERNRDRLERSQQFRQPG 60 MCSRMADEPRLEAGAHPFEEGRDKAPELRATQMDHVRFTEGRRERNRDRLERSQQFRQPG Sbjct 17 MCSRMADEPRLEAGAHPFEEGRDKAPELRATQMDHVRFTEGRRERNRDRLERSQQFRQPG 76 Query 61 R 61 R Sbjct 77 R 77 >gi|15608256|ref|NP_215632.1| hypothetical protein Rv1116 [Mycobacterium tuberculosis H37Rv] gi|31792309|ref|NP_854802.1| hypothetical protein Mb1146 [Mycobacterium bovis AF2122/97] gi|121637047|ref|YP_977270.1| hypothetical protein BCG_1176 [Mycobacterium bovis BCG str. Pasteur 1173P2] 41 more sequence titlesLength=61 Score = 123 bits (308), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%) Query 1 MCSRMADEPRLEAGAHPFEEGRDKAPELRATQMDHVRFTEGRRERNRDRLERSQQFRQPG 60 MCSRMADEPRLEAGAHPFEEGRDKAPELRATQMDHVRFTEGRRERNRDRLERSQQFRQPG Sbjct 1 MCSRMADEPRLEAGAHPFEEGRDKAPELRATQMDHVRFTEGRRERNRDRLERSQQFRQPG 60 Query 61 R 61 R Sbjct 61 R 61 Lambda K H 0.320 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 132083333032 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40