BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1473A Length=63 Score E Sequences producing significant alignments: (Bits) Value gi|15840934|ref|NP_335971.1| hypothetical protein MT1520 [Mycoba... 124 7e-27 gi|31792668|ref|NP_855161.1| transcriptional regulatory protein ... 121 3e-26 gi|289745224|ref|ZP_06504602.1| hypothetical transcriptional reg... 120 5e-26 gi|118617143|ref|YP_905475.1| transcriptional regulatory protein... 112 2e-23 gi|240172217|ref|ZP_04750876.1| transcriptional regulatory prote... 106 1e-21 gi|296170666|ref|ZP_06852241.1| probable transcriptional regulat... 99.0 2e-19 gi|254819543|ref|ZP_05224544.1| hypothetical protein MintA_06439... 98.6 3e-19 gi|126435068|ref|YP_001070759.1| hypothetical protein Mjls_2484 ... 96.7 1e-18 gi|108799414|ref|YP_639611.1| hypothetical protein Mmcs_2447 [My... 96.3 1e-18 gi|41407297|ref|NP_960133.1| hypothetical protein MAP1199 [Mycob... 93.6 9e-18 gi|342858764|ref|ZP_08715419.1| hypothetical protein MCOL_07801 ... 93.2 1e-17 gi|333990881|ref|YP_004523495.1| transcriptional regulator [Myco... 91.7 3e-17 gi|336458026|gb|EGO37013.1| hypothetical protein MAPs_17240 [Myc... 91.7 3e-17 gi|120403727|ref|YP_953556.1| hypothetical protein Mvan_2743 [My... 89.0 2e-16 gi|145224251|ref|YP_001134929.1| hypothetical protein Mflv_3667 ... 88.2 4e-16 gi|118472368|ref|YP_887456.1| hypothetical protein MSMEG_3141 [M... 87.8 5e-16 gi|302518312|ref|ZP_07270654.1| transcriptional regulator [Strep... 68.2 4e-10 gi|333028018|ref|ZP_08456082.1| putative transcriptional regulat... 68.2 4e-10 gi|86740379|ref|YP_480779.1| transcriptional regulator [Frankia ... 67.8 5e-10 gi|295839634|ref|ZP_06826567.1| transcriptional regulator [Strep... 67.8 5e-10 gi|336177744|ref|YP_004583119.1| putative transcriptional regula... 67.0 8e-10 gi|312198636|ref|YP_004018697.1| transcriptional regulator [Fran... 67.0 1e-09 gi|291450671|ref|ZP_06590061.1| transcriptional regulator [Strep... 66.6 1e-09 gi|54025457|ref|YP_119699.1| hypothetical protein nfa34870 [Noca... 66.6 1e-09 gi|312139639|ref|YP_004006975.1| hypothetical protein REQ_22390 ... 66.2 2e-09 gi|21220328|ref|NP_626107.1| transcriptional regulator [Streptom... 65.9 2e-09 gi|302550515|ref|ZP_07302857.1| predicted protein [Streptomyces ... 65.9 2e-09 gi|239986803|ref|ZP_04707467.1| hypothetical protein SrosN1_0579... 65.5 2e-09 gi|329940736|ref|ZP_08290016.1| putative transcriptional regulat... 65.5 2e-09 gi|302533724|ref|ZP_07286066.1| transcriptional regulator [Strep... 65.5 2e-09 gi|297198763|ref|ZP_06916160.1| transcriptional regulator [Strep... 65.5 2e-09 gi|288923681|ref|ZP_06417783.1| hypothetical protein FrEUN1fDRAF... 65.5 2e-09 gi|158314040|ref|YP_001506548.1| putative transcriptional regula... 65.5 2e-09 gi|182439447|ref|YP_001827166.1| hypothetical protein SGR_5654 [... 65.5 2e-09 gi|302561374|ref|ZP_07313716.1| transcriptional regulator [Strep... 65.5 3e-09 gi|29832969|ref|NP_827603.1| transcriptional regulator [Streptom... 65.5 3e-09 gi|256379140|ref|YP_003102800.1| transcriptional regulator [Acti... 65.5 3e-09 gi|291440439|ref|ZP_06579829.1| predicted protein [Streptomyces ... 65.5 3e-09 gi|328881533|emb|CCA54772.1| putative transcriptional regulator ... 65.5 3e-09 gi|326780111|ref|ZP_08239376.1| hypothetical protein SACT1_5984 ... 65.5 3e-09 gi|294811891|ref|ZP_06770534.1| Transcriptional regulator [Strep... 65.1 4e-09 gi|256391467|ref|YP_003113031.1| transcriptional regulator [Cate... 64.3 6e-09 gi|331697191|ref|YP_004333430.1| transcriptional regulator [Pseu... 64.3 6e-09 gi|297195145|ref|ZP_06912543.1| transcriptional regulator [Strep... 63.9 7e-09 gi|254386424|ref|ZP_05001729.1| transcriptional regulator [Strep... 63.9 7e-09 gi|302525949|ref|ZP_07278291.1| transcriptional regulator [Strep... 63.9 7e-09 gi|300784767|ref|YP_003765058.1| hypothetical protein AMED_2862 ... 63.9 9e-09 gi|271967253|ref|YP_003341449.1| transcriptional regulator [Stre... 63.5 9e-09 gi|134098758|ref|YP_001104419.1| transcriptional regulator [Sacc... 63.2 1e-08 gi|337765049|emb|CCB73758.1| putative transcriptional regulator ... 63.2 1e-08 >gi|15840934|ref|NP_335971.1| hypothetical protein MT1520 [Mycobacterium tuberculosis CDC1551] gi|57116871|ref|YP_177644.1| transcriptional regulatory protein [Mycobacterium tuberculosis H37Rv] gi|148661266|ref|YP_001282789.1| putative transcriptional regulatory protein [Mycobacterium tuberculosis H37Ra] 67 more sequence titles Length=63 Score = 124 bits (310), Expect = 7e-27, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS Sbjct 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 Query 61 RPR 63 RPR Sbjct 61 RPR 63 >gi|31792668|ref|NP_855161.1| transcriptional regulatory protein [Mycobacterium bovis AF2122/97] gi|121637404|ref|YP_977627.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224989879|ref|YP_002644566.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Tokyo 172] gi|31618258|emb|CAD96176.1| POSSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN [Mycobacterium bovis AF2122/97] gi|121493051|emb|CAL71522.1| Possible transcriptional regulatory protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224772992|dbj|BAH25798.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Tokyo 172] gi|341601423|emb|CCC64096.1| possible transcriptional regulatory protein [Mycobacterium bovis BCG str. Moreau RDJ] Length=63 Score = 121 bits (304), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 62/63 (99%), Positives = 62/63 (99%), Gaps = 0/63 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRR Sbjct 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRP 60 Query 61 RPR 63 RPR Sbjct 61 RPR 63 >gi|289745224|ref|ZP_06504602.1| hypothetical transcriptional regulatory protein [Mycobacterium tuberculosis 02_1987] gi|289685752|gb|EFD53240.1| hypothetical transcriptional regulatory protein [Mycobacterium tuberculosis 02_1987] Length=63 Score = 120 bits (302), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 62/63 (99%), Positives = 62/63 (99%), Gaps = 0/63 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR S Sbjct 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRGS 60 Query 61 RPR 63 RPR Sbjct 61 RPR 63 >gi|118617143|ref|YP_905475.1| transcriptional regulatory protein [Mycobacterium ulcerans Agy99] gi|183982293|ref|YP_001850584.1| transcriptional regulatory protein [Mycobacterium marinum M] gi|118569253|gb|ABL04004.1| transcriptional regulatory protein [Mycobacterium ulcerans Agy99] gi|183175619|gb|ACC40729.1| transcriptional regulatory protein [Mycobacterium marinum M] Length=63 Score = 112 bits (280), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 56/63 (89%), Positives = 58/63 (93%), Gaps = 0/63 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 MRKSKKTRDQLL ELR+AYE GASIRNLAA TGRSYGS+HSMLRESGTTMR RGGPN RS Sbjct 1 MRKSKKTRDQLLDELRHAYEAGASIRNLAANTGRSYGSVHSMLRESGTTMRSRGGPNHRS 60 Query 61 RPR 63 RPR Sbjct 61 RPR 63 >gi|240172217|ref|ZP_04750876.1| transcriptional regulatory protein [Mycobacterium kansasii ATCC 12478] Length=68 Score = 106 bits (264), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 52/61 (86%), Positives = 55/61 (91%), Gaps = 0/61 (0%) Query 2 RKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSR 61 RKSKKTRDQLL ELRNAYEGGASIR LAA+ GRSYGS+HSML ESGTTMR RGGPN R+R Sbjct 5 RKSKKTRDQLLHELRNAYEGGASIRKLAASVGRSYGSVHSMLLESGTTMRSRGGPNHRAR 64 Query 62 P 62 P Sbjct 65 P 65 >gi|296170666|ref|ZP_06852241.1| probable transcriptional regulatory protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295894655|gb|EFG74389.1| probable transcriptional regulatory protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=69 Score = 99.0 bits (245), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 55/61 (91%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 +++SKKTR+QLL ELRNAYEGGASIR L A+TGRSYGSIHSML ++GTTMRGRGGPN S Sbjct 5 LQRSKKTREQLLFELRNAYEGGASIRTLVASTGRSYGSIHSMLLQAGTTMRGRGGPNHTS 64 Query 61 R 61 R Sbjct 65 R 65 >gi|254819543|ref|ZP_05224544.1| hypothetical protein MintA_06439 [Mycobacterium intracellulare ATCC 13950] Length=65 Score = 98.6 bits (244), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 M +S K RDQLL ELR+AYEGGASIR+L ATTGRSYGSIHS+LRESGTTMR RGGPNR + Sbjct 1 MHRSAKARDQLLDELRHAYEGGASIRSLVATTGRSYGSIHSLLRESGTTMRSRGGPNRTA 60 Query 61 R 61 + Sbjct 61 K 61 >gi|126435068|ref|YP_001070759.1| hypothetical protein Mjls_2484 [Mycobacterium sp. JLS] gi|126234868|gb|ABN98268.1| conserved hypothetical protein [Mycobacterium sp. JLS] Length=66 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 M+KS+K+R++LL ELR YEGGASIR L A TGRSYGSIHSMLRESGTTMR RGGPN RS Sbjct 1 MKKSEKSREELLNELRAEYEGGASIRALVAKTGRSYGSIHSMLRESGTTMRSRGGPNHRS 60 Query 61 R 61 R Sbjct 61 R 61 >gi|108799414|ref|YP_639611.1| hypothetical protein Mmcs_2447 [Mycobacterium sp. MCS] gi|119868527|ref|YP_938479.1| hypothetical protein Mkms_2492 [Mycobacterium sp. KMS] gi|108769833|gb|ABG08555.1| conserved hypothetical protein [Mycobacterium sp. MCS] gi|119694616|gb|ABL91689.1| conserved hypothetical protein [Mycobacterium sp. KMS] Length=66 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 M+KS+K+R++LL ELR YEGGASIR L A TGRSYGSIHSMLRESGTTMR RGGPN RS Sbjct 1 MKKSEKSREELLNELRAEYEGGASIRALVAKTGRSYGSIHSMLRESGTTMRSRGGPNHRS 60 Query 61 R 61 R Sbjct 61 R 61 >gi|41407297|ref|NP_960133.1| hypothetical protein MAP1199 [Mycobacterium avium subsp. paratuberculosis K-10] gi|118465126|ref|YP_882487.1| hypothetical protein MAV_3304 [Mycobacterium avium 104] gi|254775750|ref|ZP_05217266.1| hypothetical protein MaviaA2_13930 [Mycobacterium avium subsp. avium ATCC 25291] gi|41395649|gb|AAS03516.1| hypothetical protein MAP_1199 [Mycobacterium avium subsp. paratuberculosis K-10] gi|118166413|gb|ABK67310.1| conserved domain protein [Mycobacterium avium 104] Length=65 Score = 93.6 bits (231), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 46/61 (76%), Positives = 53/61 (87%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 M++S +RDQLL ELR+AYE GASIR+L A TGRSYGSIHSMLRESGTTMR RGGPNR + Sbjct 1 MQRSANSRDQLLDELRHAYESGASIRSLVARTGRSYGSIHSMLRESGTTMRSRGGPNRTA 60 Query 61 R 61 + Sbjct 61 K 61 >gi|342858764|ref|ZP_08715419.1| hypothetical protein MCOL_07801 [Mycobacterium colombiense CECT 3035] gi|342134468|gb|EGT87648.1| hypothetical protein MCOL_07801 [Mycobacterium colombiense CECT 3035] Length=69 Score = 93.2 bits (230), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 +++S RDQLL ELR+AYEGGASIR+L A TGRSYGSIHS+LRESGTTMR RGGPNR + Sbjct 5 LQRSANARDQLLDELRHAYEGGASIRSLVAKTGRSYGSIHSLLRESGTTMRSRGGPNRTA 64 Query 61 R 61 + Sbjct 65 K 65 >gi|333990881|ref|YP_004523495.1| transcriptional regulator [Mycobacterium sp. JDM601] gi|333486849|gb|AEF36241.1| transcriptional regulatory protein [Mycobacterium sp. JDM601] Length=65 Score = 91.7 bits (226), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 46/61 (76%), Positives = 50/61 (82%), Gaps = 0/61 (0%) Query 3 KSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRP 62 K K RD+ L ELRNAYEGGASIR LAA+TGRSYGS+HSMLRESG MR RGGPN R+R Sbjct 5 KPDKLRDRQLVELRNAYEGGASIRTLAASTGRSYGSVHSMLRESGVAMRSRGGPNHRTRS 64 Query 63 R 63 R Sbjct 65 R 65 >gi|336458026|gb|EGO37013.1| hypothetical protein MAPs_17240 [Mycobacterium avium subsp. paratuberculosis S397] Length=69 Score = 91.7 bits (226), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 +++S +RDQLL ELR+AYE GASIR+L A TGRSYGSIHSMLRESGTTMR RGGPNR Sbjct 5 VQRSANSRDQLLDELRHAYESGASIRSLVARTGRSYGSIHSMLRESGTTMRSRGGPNR 62 >gi|120403727|ref|YP_953556.1| hypothetical protein Mvan_2743 [Mycobacterium vanbaalenii PYR-1] gi|119956545|gb|ABM13550.1| hypothetical protein Mvan_2743 [Mycobacterium vanbaalenii PYR-1] Length=87 Score = 89.0 bits (219), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 44/61 (73%), Positives = 52/61 (86%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 ++K+ K++DQL+ ELR+AYE GASIR+L ATTG SYGSIHSMLRESGT MR RGGPN R Sbjct 24 VKKNGKSKDQLMTELRSAYERGASIRSLVATTGHSYGSIHSMLRESGTPMRSRGGPNHRG 83 Query 61 R 61 R Sbjct 84 R 84 >gi|145224251|ref|YP_001134929.1| hypothetical protein Mflv_3667 [Mycobacterium gilvum PYR-GCK] gi|315444587|ref|YP_004077466.1| hypothetical protein Mspyr1_30130 [Mycobacterium sp. Spyr1] gi|145216737|gb|ABP46141.1| conserved hypothetical protein [Mycobacterium gilvum PYR-GCK] gi|315262890|gb|ADT99631.1| hypothetical protein Mspyr1_30130 [Mycobacterium sp. Spyr1] Length=64 Score = 88.2 bits (217), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 43/61 (71%), Positives = 50/61 (82%), Gaps = 0/61 (0%) Query 1 MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRS 60 M+ K+RDQL+ ELRNAYE GASIR+L A+TG SYGSIHS+LRE+G TMR RGGPN R Sbjct 1 MKNIGKSRDQLMSELRNAYERGASIRSLVASTGHSYGSIHSLLREAGVTMRSRGGPNHRG 60 Query 61 R 61 R Sbjct 61 R 61 >gi|118472368|ref|YP_887456.1| hypothetical protein MSMEG_3141 [Mycobacterium smegmatis str. MC2 155] gi|118173655|gb|ABK74551.1| conserved domain protein [Mycobacterium smegmatis str. MC2 155] Length=65 Score = 87.8 bits (216), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 45/60 (75%), Positives = 49/60 (82%), Gaps = 0/60 (0%) Query 4 SKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR 63 S RD+LL ELR AYE GASIR+L A TGRSYGSIHS+LRESGTTMR RGGPN RS+ R Sbjct 5 SYSNRDELLTELRRAYEEGASIRSLVARTGRSYGSIHSLLRESGTTMRSRGGPNHRSKQR 64 >gi|302518312|ref|ZP_07270654.1| transcriptional regulator [Streptomyces sp. SPB78] gi|318057707|ref|ZP_07976430.1| transcriptional regulator [Streptomyces sp. SA3_actG] gi|318080687|ref|ZP_07988019.1| transcriptional regulator [Streptomyces sp. SA3_actF] gi|302427207|gb|EFK99022.1| transcriptional regulator [Streptomyces sp. SPB78] Length=74 Score = 68.2 bits (165), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD L +L+ Y+GGASIR LA TGRSYG +H ML+ESG T+RGRGG R Sbjct 16 RDTLAADLKKKYDGGASIRALAEETGRSYGFVHRMLKESGVTLRGRGGATR 66 >gi|333028018|ref|ZP_08456082.1| putative transcriptional regulator [Streptomyces sp. Tu6071] gi|332747870|gb|EGJ78311.1| putative transcriptional regulator [Streptomyces sp. Tu6071] Length=102 Score = 68.2 bits (165), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD L +L+ Y+GGASIR LA TGRSYG +H ML+ESG T+RGRGG R Sbjct 44 RDTLAADLKKKYDGGASIRALAEETGRSYGFVHRMLKESGVTLRGRGGATR 94 >gi|86740379|ref|YP_480779.1| transcriptional regulator [Frankia sp. CcI3] gi|111223934|ref|YP_714728.1| putative transcriptional regulator [Frankia alni ACN14a] gi|86567241|gb|ABD11050.1| transcriptional regulator [Frankia sp. CcI3] gi|111151466|emb|CAJ63183.1| Putative transcriptional regulator [Frankia alni ACN14a] Length=72 Score = 67.8 bits (164), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR 63 RD+L ELR YEGG SIR LA ++GRSYG +H +L ESGTT+RGRGG R ++ + Sbjct 15 RDKLAAELRKKYEGGQSIRLLAESSGRSYGFVHRILSESGTTLRGRGGATRGTKKK 70 >gi|295839634|ref|ZP_06826567.1| transcriptional regulator [Streptomyces sp. SPB74] gi|197698473|gb|EDY45406.1| transcriptional regulator [Streptomyces sp. SPB74] Length=74 Score = 67.8 bits (164), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRP 62 RD L +L+ Y+GGASIR LA TGRSYG +H ML+ESG T+RGRGG R R Sbjct 16 RDTLAADLKKKYDGGASIRALAEETGRSYGFVHRMLKESGVTLRGRGGATRGKRT 70 >gi|336177744|ref|YP_004583119.1| putative transcriptional regulator [Frankia symbiont of Datisca glomerata] gi|334858724|gb|AEH09198.1| putative transcriptional regulator [Frankia symbiont of Datisca glomerata] Length=72 Score = 67.0 bits (162), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 33/56 (59%), Positives = 41/56 (74%), Gaps = 0/56 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR 63 RD+L ELR YE G SIR LA ++GRSYG +H +L ESGTT+RGRGG R S+ + Sbjct 15 RDKLASELRKKYEAGQSIRLLAESSGRSYGFVHRILSESGTTLRGRGGATRGSKKK 70 >gi|312198636|ref|YP_004018697.1| transcriptional regulator [Frankia sp. EuI1c] gi|311229972|gb|ADP82827.1| putative transcriptional regulator [Frankia sp. EuI1c] Length=86 Score = 67.0 bits (162), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/56 (59%), Positives = 41/56 (74%), Gaps = 0/56 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR 63 RD+L ELR YE G SIR LA ++GRSYG +H +L ESGTT+RGRGG R S+ + Sbjct 29 RDKLAAELRKKYESGQSIRLLAESSGRSYGFVHRILSESGTTLRGRGGATRGSKKK 84 >gi|291450671|ref|ZP_06590061.1| transcriptional regulator [Streptomyces albus J1074] gi|291353620|gb|EFE80522.1| transcriptional regulator [Streptomyces albus J1074] Length=73 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 32/55 (59%), Positives = 39/55 (71%), Gaps = 0/55 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRP 62 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R +P Sbjct 16 RDKLAADLKRKYDDGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATRGKKP 70 >gi|54025457|ref|YP_119699.1| hypothetical protein nfa34870 [Nocardia farcinica IFM 10152] gi|54016965|dbj|BAD58335.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=79 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%) Query 6 KTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRP 62 K+RD+L +L+ YE GASIR+LA TGRSYG IH++L ES +R RGG NRR P Sbjct 21 KSRDRLQSQLKKQYEQGASIRSLARATGRSYGFIHNVLVESHVQLRSRGGANRRKNP 77 >gi|312139639|ref|YP_004006975.1| hypothetical protein REQ_22390 [Rhodococcus equi 103S] gi|325676685|ref|ZP_08156359.1| transcriptional regulator [Rhodococcus equi ATCC 33707] gi|311888978|emb|CBH48291.1| conserved hypothetical protein [Rhodococcus equi 103S] gi|325552467|gb|EGD22155.1| transcriptional regulator [Rhodococcus equi ATCC 33707] Length=74 Score = 66.2 bits (160), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 33/60 (55%), Positives = 44/60 (74%), Gaps = 0/60 (0%) Query 2 RKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSR 61 R + ++RD+L +L+ YE GASIR LA TGRSYG IH++L E+ T+R RGGPNRR + Sbjct 12 RITGESRDKLRDDLKAQYEAGASIRTLANQTGRSYGFIHNVLVEADVTLRRRGGPNRRKK 71 >gi|21220328|ref|NP_626107.1| transcriptional regulator [Streptomyces coelicolor A3(2)] gi|289772443|ref|ZP_06531821.1| predicted protein [Streptomyces lividans TK24] gi|6117882|emb|CAB59455.1| putative transcriptional regulator [Streptomyces coelicolor A3(2)] gi|289702642|gb|EFD70071.1| predicted protein [Streptomyces lividans TK24] Length=73 Score = 65.9 bits (159), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDAGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|302550515|ref|ZP_07302857.1| predicted protein [Streptomyces viridochromogenes DSM 40736] gi|302468133|gb|EFL31226.1| predicted protein [Streptomyces viridochromogenes DSM 40736] Length=87 Score = 65.9 bits (159), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 31 RDKLAADLKKKYDAGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 81 >gi|239986803|ref|ZP_04707467.1| hypothetical protein SrosN1_05795 [Streptomyces roseosporus NRRL 11379] gi|290961446|ref|YP_003492628.1| hypothetical protein SCAB_70971 [Streptomyces scabiei 87.22] gi|291443754|ref|ZP_06583144.1| transcriptional regulator [Streptomyces roseosporus NRRL 15998] 6 more sequence titles Length=73 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|329940736|ref|ZP_08290016.1| putative transcriptional regulator [Streptomyces griseoaurantiacus M045] gi|329300030|gb|EGG43928.1| putative transcriptional regulator [Streptomyces griseoaurantiacus M045] Length=73 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|302533724|ref|ZP_07286066.1| transcriptional regulator [Streptomyces sp. C] gi|302442619|gb|EFL14435.1| transcriptional regulator [Streptomyces sp. C] Length=73 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|297198763|ref|ZP_06916160.1| transcriptional regulator [Streptomyces sviceus ATCC 29083] gi|197715354|gb|EDY59388.1| transcriptional regulator [Streptomyces sviceus ATCC 29083] Length=73 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|288923681|ref|ZP_06417783.1| hypothetical protein FrEUN1fDRAFT_7481 [Frankia sp. EUN1f] gi|288344976|gb|EFC79403.1| hypothetical protein FrEUN1fDRAFT_7481 [Frankia sp. EUN1f] Length=72 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 32/56 (58%), Positives = 41/56 (74%), Gaps = 0/56 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR 63 RD+L ELR YE G SIR LA ++GRSYG +H +L ESGTT+RGRGG R ++ + Sbjct 15 RDKLAAELRKKYESGQSIRLLAESSGRSYGFVHRILSESGTTLRGRGGATRGTKKK 70 >gi|158314040|ref|YP_001506548.1| putative transcriptional regulator [Frankia sp. EAN1pec] gi|158109445|gb|ABW11642.1| putative transcriptional regulator [Frankia sp. EAN1pec] Length=72 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 32/56 (58%), Positives = 41/56 (74%), Gaps = 0/56 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR 63 RD+L ELR YE G SIR LA ++GRSYG +H +L ESGTT+RGRGG R ++ + Sbjct 15 RDKLAAELRKKYESGQSIRLLAESSGRSYGFVHRILSESGTTLRGRGGATRGTKKK 70 >gi|182439447|ref|YP_001827166.1| hypothetical protein SGR_5654 [Streptomyces griseus subsp. griseus NBRC 13350] gi|178467963|dbj|BAG22483.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] Length=73 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|302561374|ref|ZP_07313716.1| transcriptional regulator [Streptomyces griseoflavus Tu4000] gi|302478992|gb|EFL42085.1| transcriptional regulator [Streptomyces griseoflavus Tu4000] Length=88 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 31 RDKLAADLKKKYDAGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 81 >gi|29832969|ref|NP_827603.1| transcriptional regulator [Streptomyces avermitilis MA-4680] gi|29610090|dbj|BAC74138.1| putative transcriptional regulator [Streptomyces avermitilis MA-4680] Length=73 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|256379140|ref|YP_003102800.1| transcriptional regulator [Actinosynnema mirum DSM 43827] gi|255923443|gb|ACU38954.1| transcriptional regulator [Actinosynnema mirum DSM 43827] Length=69 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/52 (60%), Positives = 38/52 (74%), Gaps = 0/52 (0%) Query 7 TRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 TRD+L +L+ YE GASIR LA +TGRSYG +H +L ESG +RGRGG R Sbjct 14 TRDKLAADLKKKYEKGASIRALAESTGRSYGFVHRVLSESGVQLRGRGGATR 65 >gi|291440439|ref|ZP_06579829.1| predicted protein [Streptomyces ghanaensis ATCC 14672] gi|291343334|gb|EFE70290.1| predicted protein [Streptomyces ghanaensis ATCC 14672] Length=88 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 31 RDKLAADLKKKYDAGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 81 >gi|328881533|emb|CCA54772.1| putative transcriptional regulator [Streptomyces venezuelae ATCC 10712] Length=86 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 29 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 79 >gi|326780111|ref|ZP_08239376.1| hypothetical protein SACT1_5984 [Streptomyces cf. griseus XylebKG-1] gi|326660444|gb|EGE45290.1| hypothetical protein SACT1_5984 [Streptomyces griseus XylebKG-1] Length=86 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 29 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 79 >gi|294811891|ref|ZP_06770534.1| Transcriptional regulator [Streptomyces clavuligerus ATCC 27064] gi|294324490|gb|EFG06133.1| Transcriptional regulator [Streptomyces clavuligerus ATCC 27064] Length=106 Score = 65.1 bits (157), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 49 RDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 99 >gi|256391467|ref|YP_003113031.1| transcriptional regulator [Catenulispora acidiphila DSM 44928] gi|256357693|gb|ACU71190.1| transcriptional regulator [Catenulispora acidiphila DSM 44928] Length=72 Score = 64.3 bits (155), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 R QL +L+ YE G SIR LA +TGRSYG +H ML ESG T+RGRGG R Sbjct 16 RSQLATDLKAKYEAGESIRALAQSTGRSYGFVHRMLSESGVTLRGRGGATR 66 >gi|331697191|ref|YP_004333430.1| transcriptional regulator [Pseudonocardia dioxanivorans CB1190] gi|326951880|gb|AEA25577.1| transcriptional regulator [Pseudonocardia dioxanivorans CB1190] Length=69 Score = 64.3 bits (155), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ YE GASIR LA TGRSYG +H +L E+G T+RGRGG R Sbjct 15 RDKLATDLKKKYEKGASIRALAEQTGRSYGFVHRVLSETGVTLRGRGGATR 65 >gi|297195145|ref|ZP_06912543.1| transcriptional regulator [Streptomyces pristinaespiralis ATCC 25486] gi|197723504|gb|EDY67412.1| transcriptional regulator [Streptomyces pristinaespiralis ATCC 25486] Length=73 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/52 (58%), Positives = 36/52 (70%), Gaps = 0/52 (0%) Query 7 TRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG +RGRGG R Sbjct 15 ARDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVVLRGRGGATR 66 >gi|254386424|ref|ZP_05001729.1| transcriptional regulator [Streptomyces sp. Mg1] gi|194345274|gb|EDX26240.1| transcriptional regulator [Streptomyces sp. Mg1] Length=73 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/52 (58%), Positives = 36/52 (70%), Gaps = 0/52 (0%) Query 7 TRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y+ GASIR LA TGRSYG +H ML ESG +RGRGG R Sbjct 15 ARDKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVVLRGRGGATR 66 >gi|302525949|ref|ZP_07278291.1| transcriptional regulator [Streptomyces sp. AA4] gi|302434844|gb|EFL06660.1| transcriptional regulator [Streptomyces sp. AA4] gi|340526193|gb|AEK41398.1| hypothetical protein RAM_14550 [Amycolatopsis mediterranei S699] Length=69 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/52 (58%), Positives = 38/52 (74%), Gaps = 0/52 (0%) Query 7 TRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 TRD+L +L+ YE G+SIR LA +TGRSYG +H +L ESG +RGRGG R Sbjct 14 TRDKLAADLKKKYEKGSSIRALAESTGRSYGFVHRVLSESGVQLRGRGGATR 65 >gi|300784767|ref|YP_003765058.1| hypothetical protein AMED_2862 [Amycolatopsis mediterranei U32] gi|299794281|gb|ADJ44656.1| conserved hypothetical protein [Amycolatopsis mediterranei U32] Length=81 Score = 63.9 bits (154), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 30/52 (58%), Positives = 38/52 (74%), Gaps = 0/52 (0%) Query 7 TRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 TRD+L +L+ YE G+SIR LA +TGRSYG +H +L ESG +RGRGG R Sbjct 26 TRDKLAADLKKKYEKGSSIRALAESTGRSYGFVHRVLSESGVQLRGRGGATR 77 >gi|271967253|ref|YP_003341449.1| transcriptional regulator [Streptosporangium roseum DSM 43021] gi|270510428|gb|ACZ88706.1| transcriptional regulator [Streptosporangium roseum DSM 43021] Length=71 Score = 63.5 bits (153), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ Y G SIR LAA+TGRSYG IH +L ESG T+RGRGG R Sbjct 16 RDKLAADLKKRYSAGESIRALAASTGRSYGFIHRILSESGVTLRGRGGATR 66 >gi|134098758|ref|YP_001104419.1| transcriptional regulator [Saccharopolyspora erythraea NRRL 2338] gi|291003558|ref|ZP_06561531.1| transcriptional regulator [Saccharopolyspora erythraea NRRL 2338] gi|133911381|emb|CAM01494.1| transcriptional regulator [Saccharopolyspora erythraea NRRL 2338] Length=69 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 30/52 (58%), Positives = 36/52 (70%), Gaps = 0/52 (0%) Query 7 TRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 RD+L +L+ YE GASIR LA TGRSYG +H +L ESG +RGRGG R Sbjct 14 ARDKLASDLKKKYEKGASIRALAEATGRSYGFVHRVLSESGVQLRGRGGATR 65 >gi|337765049|emb|CCB73758.1| putative transcriptional regulator [Streptomyces cattleya NRRL 8057] Length=73 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%) Query 8 RDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNR 58 R++L +L+ Y+ GASIR LA TGRSYG +H ML ESG T+RGRGG R Sbjct 16 REKLAADLKKKYDSGASIRALAEETGRSYGFVHRMLSESGVTLRGRGGATR 66 Lambda K H 0.315 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131230491224 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40