BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1693 Length=58 Score E Sequences producing significant alignments: (Bits) Value gi|15608831|ref|NP_216209.1| hypothetical protein Rv1693 [Mycoba... 110 5e-23 gi|240170142|ref|ZP_04748801.1| hypothetical protein MkanA1_1256... 96.3 1e-18 gi|183982513|ref|YP_001850804.1| hypothetical protein MMAR_2498 ... 90.9 6e-17 gi|118617310|ref|YP_905642.1| hypothetical protein MUL_1682 [Myc... 86.7 1e-15 gi|41407498|ref|NP_960334.1| hypothetical protein MAP1400 [Mycob... 85.9 2e-15 gi|254821087|ref|ZP_05226088.1| hypothetical protein MintA_14217... 84.7 4e-15 gi|342860729|ref|ZP_08717379.1| hypothetical protein MCOL_17698 ... 82.4 2e-14 gi|296164593|ref|ZP_06847160.1| conserved hypothetical protein [... 82.4 2e-14 gi|15827704|ref|NP_301967.1| hypothetical protein ML1357 [Mycoba... 80.9 6e-14 gi|333990489|ref|YP_004523103.1| hypothetical protein JDM601_184... 50.1 1e-04 gi|169629444|ref|YP_001703093.1| hypothetical protein MAB_2358 [... 49.3 2e-04 gi|108799918|ref|YP_640115.1| hypothetical protein Mmcs_2952 [My... 47.8 5e-04 gi|145224094|ref|YP_001134772.1| hypothetical protein Mflv_3510 ... 46.6 0.001 gi|120404266|ref|YP_954095.1| hypothetical protein Mvan_3291 [My... 45.1 0.003 gi|118469330|ref|YP_888049.1| hypothetical protein MSMEG_3752 [M... 44.3 0.006 gi|54023963|ref|YP_118205.1| hypothetical protein nfa19950 [Noca... 42.4 0.022 gi|289750249|ref|ZP_06509627.1| LOW QUALITY PROTEIN: conserved h... 36.2 1.8 gi|261420610|ref|YP_003254292.1| nucleotide sugar dehydrogenase ... 35.4 2.8 gi|229494832|ref|ZP_04388586.1| conserved hypothetical protein [... 35.0 3.8 gi|226360084|ref|YP_002777862.1| hypothetical protein ROP_06700 ... 35.0 4.0 gi|224985441|gb|ACN74538.1| hypothetical UDP-N-acetyl-D-mannosam... 33.9 8.9 >gi|15608831|ref|NP_216209.1| hypothetical protein Rv1693 [Mycobacterium tuberculosis H37Rv] gi|15841150|ref|NP_336187.1| hypothetical protein MT1732 [Mycobacterium tuberculosis CDC1551] gi|31792879|ref|NP_855372.1| hypothetical protein Mb1719 [Mycobacterium bovis AF2122/97] 47 more sequence titles Length=58 Score = 110 bits (276), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG Sbjct 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 >gi|240170142|ref|ZP_04748801.1| hypothetical protein MkanA1_12568 [Mycobacterium kansasii ATCC 12478] Length=58 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 50/58 (87%), Positives = 54/58 (94%), Gaps = 0/58 (0%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 MTIDPDQIR+EI+AL+A LPD ADAENGPSLAELE IARRLSEAH+VLL ALESAEKG Sbjct 1 MTIDPDQIRSEIEALVAQLPDVADAENGPSLAELEVIARRLSEAHDVLLRALESAEKG 58 >gi|183982513|ref|YP_001850804.1| hypothetical protein MMAR_2498 [Mycobacterium marinum M] gi|183175839|gb|ACC40949.1| conserved hypothetical protein [Mycobacterium marinum M] Length=58 Score = 90.9 bits (224), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 47/58 (82%), Positives = 51/58 (88%), Gaps = 0/58 (0%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 MTIDPDQIR EI++LLA LP+ AD NGPSLAELE IARRLSEAH+VLL ALESAEKG Sbjct 1 MTIDPDQIRTEIESLLAQLPEVADGANGPSLAELEDIARRLSEAHDVLLQALESAEKG 58 >gi|118617310|ref|YP_905642.1| hypothetical protein MUL_1682 [Mycobacterium ulcerans Agy99] gi|118569420|gb|ABL04171.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] Length=58 Score = 86.7 bits (213), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 46/58 (80%), Positives = 50/58 (87%), Gaps = 0/58 (0%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 MTIDPDQIR EI++LLA LP+ AD NG SLAELE IARRLSEAH+VLL ALESAEKG Sbjct 1 MTIDPDQIRTEIESLLAQLPEVADDANGLSLAELEDIARRLSEAHDVLLQALESAEKG 58 >gi|41407498|ref|NP_960334.1| hypothetical protein MAP1400 [Mycobacterium avium subsp. paratuberculosis K-10] gi|118467047|ref|YP_882262.1| hypothetical protein MAV_3078 [Mycobacterium avium 104] gi|254775530|ref|ZP_05217046.1| hypothetical protein MaviaA2_12796 [Mycobacterium avium subsp. avium ATCC 25291] gi|41395851|gb|AAS03717.1| hypothetical protein MAP_1400 [Mycobacterium avium subsp. paratuberculosis K-10] gi|118168334|gb|ABK69231.1| conserved hypothetical protein [Mycobacterium avium 104] gi|336457852|gb|EGO36846.1| hypothetical protein MAPs_19510 [Mycobacterium avium subsp. paratuberculosis S397] Length=61 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 3/61 (4%) Query 1 MTIDPDQIRAEIDALLASLPDPADAEN---GPSLAELEGIARRLSEAHEVLLAALESAEK 57 M+IDPDQIRAEIDALLA LP P D E+ PSL ELE IARRLSEAH+VLLAALESAEK Sbjct 1 MSIDPDQIRAEIDALLARLPQPGDTEDPDKAPSLDELEEIARRLSEAHDVLLAALESAEK 60 Query 58 G 58 G Sbjct 61 G 61 >gi|254821087|ref|ZP_05226088.1| hypothetical protein MintA_14217 [Mycobacterium intracellulare ATCC 13950] Length=61 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 3/61 (4%) Query 1 MTIDPDQIRAEIDALLASLPDPADAEN---GPSLAELEGIARRLSEAHEVLLAALESAEK 57 M+IDPDQIRAEIDALLA LP P D E+ PSL ELE IARRLSEAH+VLLAALESAEK Sbjct 1 MSIDPDQIRAEIDALLARLPRPGDQEDPEKAPSLDELEEIARRLSEAHDVLLAALESAEK 60 Query 58 G 58 G Sbjct 61 G 61 >gi|342860729|ref|ZP_08717379.1| hypothetical protein MCOL_17698 [Mycobacterium colombiense CECT 3035] gi|342131753|gb|EGT85010.1| hypothetical protein MCOL_17698 [Mycobacterium colombiense CECT 3035] Length=61 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 48/61 (79%), Positives = 50/61 (82%), Gaps = 3/61 (4%) Query 1 MTIDPDQIRAEIDALLASLP---DPADAENGPSLAELEGIARRLSEAHEVLLAALESAEK 57 MTIDPD+IRAEIDALLA LP D D E PSL ELE IARRLSEAH+VLLAALESAEK Sbjct 1 MTIDPDEIRAEIDALLARLPQAGDTEDPEQVPSLDELEEIARRLSEAHDVLLAALESAEK 60 Query 58 G 58 G Sbjct 61 G 61 >gi|296164593|ref|ZP_06847160.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295900012|gb|EFG79451.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=61 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 46/61 (76%), Positives = 52/61 (86%), Gaps = 3/61 (4%) Query 1 MTIDPDQIRAEIDALLASLPDPA---DAENGPSLAELEGIARRLSEAHEVLLAALESAEK 57 MTIDP++IRAEIDALLA LP+P +N PSL+ELE IARRLSEAH+VLLAALESAEK Sbjct 1 MTIDPEEIRAEIDALLARLPEPGAGDTPDNQPSLSELEEIARRLSEAHDVLLAALESAEK 60 Query 58 G 58 G Sbjct 61 G 61 >gi|15827704|ref|NP_301967.1| hypothetical protein ML1357 [Mycobacterium leprae TN] gi|221230181|ref|YP_002503597.1| hypothetical protein MLBr_01357 [Mycobacterium leprae Br4923] gi|13093255|emb|CAC31738.1| conserved hypothetical protein [Mycobacterium leprae] gi|219933288|emb|CAR71452.1| conserved hypothetical protein [Mycobacterium leprae Br4923] Length=61 Score = 80.9 bits (198), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 45/61 (74%), Positives = 48/61 (79%), Gaps = 3/61 (4%) Query 1 MTIDPDQIRAEIDALLASLPDPADAEN---GPSLAELEGIARRLSEAHEVLLAALESAEK 57 MTIDPDQIRAEIDALLA LPD AD E+ G SLA+LE +A R SE H VLL ALESAEK Sbjct 1 MTIDPDQIRAEIDALLAQLPDFADLEDSVSGLSLAQLEEVALRFSEVHSVLLQALESAEK 60 Query 58 G 58 G Sbjct 61 G 61 >gi|333990489|ref|YP_004523103.1| hypothetical protein JDM601_1849 [Mycobacterium sp. JDM601] gi|333486457|gb|AEF35849.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=58 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 M + D +R I ALLA LP A+ P+ ++L +A+RL AHEVL+AALES EKG Sbjct 1 MNSEIDDVRERIAALLAELPGEAELAELPAHSDLNALAQRLEAAHEVLVAALESVEKG 58 >gi|169629444|ref|YP_001703093.1| hypothetical protein MAB_2358 [Mycobacterium abscessus ATCC 19977] gi|169241411|emb|CAM62439.1| Conserved hypothetical protein [Mycobacterium abscessus] Length=69 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 27/55 (50%), Positives = 38/55 (70%), Gaps = 0/55 (0%) Query 4 DPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 DPD++R+ + ALL L PA A + S +LE A+ L +AH+VL+ ALESAE+G Sbjct 15 DPDEVRSRVQALLGQLDSPAGAGDTESDLDLENQAQILEQAHDVLVRALESAEQG 69 >gi|108799918|ref|YP_640115.1| hypothetical protein Mmcs_2952 [Mycobacterium sp. MCS] gi|119869028|ref|YP_938980.1| hypothetical protein Mkms_2996 [Mycobacterium sp. KMS] gi|126435546|ref|YP_001071237.1| hypothetical protein Mjls_2967 [Mycobacterium sp. JLS] gi|108770337|gb|ABG09059.1| conserved hypothetical protein [Mycobacterium sp. MCS] gi|119695117|gb|ABL92190.1| conserved hypothetical protein [Mycobacterium sp. KMS] gi|126235346|gb|ABN98746.1| conserved hypothetical protein [Mycobacterium sp. JLS] Length=61 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 39/58 (68%), Gaps = 1/58 (1%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 M+ DPDQ+R + ALLA LP+P D + +++ +A RL EAH++L+ AL + EKG Sbjct 5 MSNDPDQLRTRVAALLADLPEP-DHAGDLADCDIDTVAARLEEAHDLLVQALAAVEKG 61 >gi|145224094|ref|YP_001134772.1| hypothetical protein Mflv_3510 [Mycobacterium gilvum PYR-GCK] gi|315444431|ref|YP_004077310.1| hypothetical protein Mspyr1_28490 [Mycobacterium sp. Spyr1] gi|145216580|gb|ABP45984.1| conserved hypothetical protein [Mycobacterium gilvum PYR-GCK] gi|315262734|gb|ADT99475.1| hypothetical protein Mspyr1_28490 [Mycobacterium sp. Spyr1] Length=51 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 28/58 (49%), Positives = 37/58 (64%), Gaps = 7/58 (12%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 M+ DPDQIRA+I LL D S ++L+ +A RL EAH++L+ ALES EKG Sbjct 1 MSNDPDQIRAQIAELLGERTDL-------SASDLDSVAARLEEAHDLLVRALESVEKG 51 >gi|120404266|ref|YP_954095.1| hypothetical protein Mvan_3291 [Mycobacterium vanbaalenii PYR-1] gi|119957084|gb|ABM14089.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] Length=54 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 8/58 (13%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG 58 M+ DPDQIRA++ LL PD + ++L+ +A RL EAH++L+ ALES EKG Sbjct 5 MSNDPDQIRAQVAELLGQ-PDV-------TASDLDAVAARLEEAHDLLVRALESVEKG 54 >gi|118469330|ref|YP_888049.1| hypothetical protein MSMEG_3752 [Mycobacterium smegmatis str. MC2 155] gi|118170617|gb|ABK71513.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2 155] Length=68 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 25/60 (42%), Positives = 41/60 (69%), Gaps = 4/60 (6%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSL--AELEGIARRLSEAHEVLLAALESAEKG 58 MT DPDQ+RA + +LA LPD + +G L +++ +A +L +AH++L+ ALE+ +KG Sbjct 1 MTTDPDQLRARVAEVLADLPDL--SADGSELVDTDIDLLAAKLEQAHDLLVQALETVDKG 58 >gi|54023963|ref|YP_118205.1| hypothetical protein nfa19950 [Nocardia farcinica IFM 10152] gi|54015471|dbj|BAD56841.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=88 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 28/58 (49%), Positives = 37/58 (64%), Gaps = 4/58 (6%) Query 4 DPDQIRAEIDALLASL----PDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEK 57 DPD+IRAEID LLA L P AE+ + A++ AR L +AHEVL+ AL + +K Sbjct 30 DPDRIRAEIDELLAELDAGGGRPGPAEHAETGADITRRARILEQAHEVLVQALATVDK 87 >gi|289750249|ref|ZP_06509627.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289690836|gb|EFD58265.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis T92] Length=60 Score = 36.2 bits (82), Expect = 1.8, Method: Compositional matrix adjust. Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 0/33 (0%) Query 1 MTIDPDQIRAEIDALLASLPDPADAENGPSLAE 33 MTIDPDQIRA +SLPD + +G SLA+ Sbjct 1 MTIDPDQIRARQSPPTSSLPDQTMSRHGQSLAQ 33 >gi|261420610|ref|YP_003254292.1| nucleotide sugar dehydrogenase [Geobacillus sp. Y412MC61] gi|319768281|ref|YP_004133782.1| nucleotide sugar dehydrogenase [Geobacillus sp. Y412MC52] gi|261377067|gb|ACX79810.1| nucleotide sugar dehydrogenase [Geobacillus sp. Y412MC61] gi|317113147|gb|ADU95639.1| nucleotide sugar dehydrogenase [Geobacillus sp. Y412MC52] Length=437 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 18/46 (40%), Positives = 30/46 (66%), Gaps = 1/46 (2%) Query 10 AEIDALLASLPDPADAENGPSLAELEGIARRLSE-AHEVLLAALES 54 AE+DA+ ++P P DA + P + +E A+ +++ AHE +L LES Sbjct 88 AEVDAVAIAVPTPLDAHHQPDTSYVENSAKEIAKYAHEGMLVVLES 133 >gi|229494832|ref|ZP_04388586.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|229318270|gb|EEN84137.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length=80 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 22/60 (37%), Positives = 35/60 (59%), Gaps = 7/60 (11%) Query 2 TIDPDQIRAEIDALLASL----PDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEK 57 ++DP++IR+++D LLA L DP D + + I L +AHEVL+ AL S ++ Sbjct 23 SVDPERIRSDVDGLLARLGGIEQDPNDQHGAGVIPQKAHI---LEQAHEVLVQALASVDR 79 >gi|226360084|ref|YP_002777862.1| hypothetical protein ROP_06700 [Rhodococcus opacus B4] gi|226238569|dbj|BAH48917.1| hypothetical protein [Rhodococcus opacus B4] Length=95 Score = 35.0 bits (79), Expect = 4.0, Method: Compositional matrix adjust. Identities = 23/60 (39%), Positives = 37/60 (62%), Gaps = 7/60 (11%) Query 2 TIDPDQIRAEIDALLASL----PDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEK 57 ++DP++I E+D LL+ L PDP D E+G + + A L +AH+VL+ AL + +K Sbjct 38 SVDPEKIHTEVDGLLSRLGAVEPDP-DDEHGAGVIPRK--AHLLEKAHDVLVEALATVDK 94 >gi|224985441|gb|ACN74538.1| hypothetical UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Geobacillus stearothermophilus] Length=437 Score = 33.9 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 17/46 (37%), Positives = 29/46 (64%), Gaps = 1/46 (2%) Query 10 AEIDALLASLPDPADAENGPSLAELEGIARRLSE-AHEVLLAALES 54 AE+DA+ ++P P D + P + +E A+ +++ AHE +L LES Sbjct 88 AEVDAVAIAVPTPLDEHHQPDTSYVENSAKEIAKYAHEGMLVVLES 133 Lambda K H 0.309 0.129 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128188454310 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40