BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1721c Length=75 Score E Sequences producing significant alignments: (Bits) Value gi|15841183|ref|NP_336220.1| hypothetical protein MT1762 [Mycoba... 140 7e-32 gi|240170954|ref|ZP_04749613.1| hypothetical protein MkanA1_1670... 130 8e-29 gi|300113933|ref|YP_003760508.1| hypothetical protein Nwat_1260 ... 57.8 5e-07 gi|217979589|ref|YP_002363736.1| hypothetical protein Msil_3485 ... 57.0 9e-07 gi|297625030|ref|YP_003706464.1| hypothetical protein Trad_2820 ... 50.8 6e-05 gi|333990433|ref|YP_004523047.1| hypothetical protein JDM601_179... 49.3 2e-04 gi|335051622|ref|ZP_08544536.1| toxin-antitoxin system, antitoxi... 48.9 3e-04 gi|50843516|ref|YP_056743.1| hypothetical protein PPA2075 [Propi... 48.9 3e-04 gi|284992099|ref|YP_003410653.1| hypothetical protein Gobs_3699 ... 48.1 4e-04 gi|269957932|ref|YP_003327721.1| hypothetical protein Xcel_3162 ... 48.1 5e-04 gi|152966079|ref|YP_001361863.1| hypothetical protein Krad_2114 ... 47.8 6e-04 gi|327335218|gb|EGE76928.1| conserved domain protein [Propioniba... 46.2 0.002 gi|314928788|gb|EFS92619.1| toxin-antitoxin system, antitoxin co... 43.5 0.010 gi|312195769|ref|YP_004015830.1| hypothetical protein FraEuI1c_1... 42.7 0.016 gi|315446138|ref|YP_004079017.1| hypothetical protein Mspyr1_463... 42.4 0.027 gi|333025633|ref|ZP_08453697.1| hypothetical protein STTU_3137 [... 40.8 0.063 gi|284992068|ref|YP_003410622.1| hypothetical protein Gobs_3667 ... 40.4 0.085 gi|134102275|ref|YP_001107936.1| hypothetical protein SACE_5827 ... 39.7 0.15 gi|336118170|ref|YP_004572939.1| hypothetical protein MLP_25220 ... 38.5 0.31 gi|218295255|ref|ZP_03496091.1| conserved hypothetical protein [... 37.0 0.93 gi|271964588|ref|YP_003338784.1| hypothetical protein Sros_3093 ... 36.6 1.2 gi|84494960|ref|ZP_00994079.1| O-succinylbenzoate synthase [Jani... 35.4 3.0 gi|312194111|ref|YP_004014172.1| hypothetical protein FraEuI1c_0... 35.0 3.5 gi|227832925|ref|YP_002834632.1| hypothetical protein cauri_1101... 35.0 3.7 gi|337766708|emb|CCB75419.1| conserved protein of unknown functi... 33.9 8.7 >gi|15841183|ref|NP_336220.1| hypothetical protein MT1762 [Mycobacterium tuberculosis CDC1551] gi|31792909|ref|NP_855402.1| hypothetical protein Mb1750c [Mycobacterium bovis AF2122/97] gi|57116902|ref|NP_216237.2| hypothetical protein Rv1721c [Mycobacterium tuberculosis H37Rv] 66 more sequence titles Length=75 Score = 140 bits (352), Expect = 7e-32, Method: Compositional matrix adjust. Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD 60 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD Sbjct 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD 60 Query 61 LGASAAELVDEARSE 75 LGASAAELVDEARSE Sbjct 61 LGASAAELVDEARSE 75 >gi|240170954|ref|ZP_04749613.1| hypothetical protein MkanA1_16708 [Mycobacterium kansasii ATCC 12478] Length=75 Score = 130 bits (326), Expect = 8e-29, Method: Compositional matrix adjust. Identities = 68/75 (91%), Positives = 71/75 (95%), Gaps = 0/75 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD 60 MS MVQIRNVPDEL+HELKARAAAQRMSLSDFLLARLAE A+EPALD+VL RLAALPRRD Sbjct 1 MSTMVQIRNVPDELVHELKARAAAQRMSLSDFLLARLAEFAQEPALDEVLGRLAALPRRD 60 Query 61 LGASAAELVDEARSE 75 LGASAAELV EARSE Sbjct 61 LGASAAELVGEARSE 75 >gi|300113933|ref|YP_003760508.1| hypothetical protein Nwat_1260 [Nitrosococcus watsonii C-113] gi|299539870|gb|ADJ28187.1| conserved hypothetical protein [Nitrosococcus watsonii C-113] Length=77 Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRL 53 MS ++Q+RNVP++L +LKARAA + M LSD+LLAR+ +E P L ++ RL Sbjct 1 MSKLIQLRNVPNKLHRKLKARAAQEGMPLSDYLLARIQRASERPTLSELRKRL 53 >gi|217979589|ref|YP_002363736.1| hypothetical protein Msil_3485 [Methylocella silvestris BL2] gi|217504965|gb|ACK52374.1| conserved hypothetical protein [Methylocella silvestris BL2] Length=76 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 31/69 (45%), Positives = 43/69 (63%), Gaps = 0/69 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD 60 M M+QIRNVP+ L ELK+RAA MSLSD+LL+ + + AE P ++++ RL + D Sbjct 1 MGVMIQIRNVPEALHRELKSRAALAGMSLSDYLLSEIRQTAERPTIEELRARLRSRTETD 60 Query 61 LGASAAELV 69 AE V Sbjct 61 PSVPPAEAV 69 >gi|297625030|ref|YP_003706464.1| hypothetical protein Trad_2820 [Truepera radiovictrix DSM 17093] gi|297166210|gb|ADI15921.1| conserved hypothetical protein [Truepera radiovictrix DSM 17093] Length=74 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 39/54 (73%), Gaps = 0/54 (0%) Query 4 MVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALP 57 M+QIRNVP+ L +LK RAA + M+LSDFLL + AE P+L++++ R+ A P Sbjct 1 MIQIRNVPEALHRKLKMRAAERGMTLSDFLLEQATIAAETPSLEELVRRIDAEP 54 >gi|333990433|ref|YP_004523047.1| hypothetical protein JDM601_1793 [Mycobacterium sp. JDM601] gi|333486401|gb|AEF35793.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=84 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 1/75 (1%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD 60 MS+++QIRNVPD + ELKARAA Q SL+ +LL ++ P + +VL R A Sbjct 1 MSSLLQIRNVPDAVRRELKARAAIQGQSLNAYLLDLISREVNRPTVAEVLQRAAQRAEHA 60 Query 61 LGASAAELVDEARSE 75 G SA ++VD R E Sbjct 61 SG-SAIDVVDADRIE 74 >gi|335051622|ref|ZP_08544536.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix domain protein [Propionibacterium sp. 409-HC1] gi|342212624|ref|ZP_08705349.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix domain protein [Propionibacterium sp. CC003-HC2] gi|313813816|gb|EFS51530.1| toxin-antitoxin system protein [Propionibacterium acnes HL025PA1] gi|333766222|gb|EGL43534.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix domain protein [Propionibacterium sp. 409-HC1] gi|340768168|gb|EGR90693.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix domain protein [Propionibacterium sp. CC003-HC2] Length=75 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 28/71 (40%), Positives = 40/71 (57%), Gaps = 0/71 (0%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLG 62 A +QIRNVP+E ELKARAA Q SLS++ L L + P+ + ++ R+ A R Sbjct 2 ATIQIRNVPEETSRELKARAALQGKSLSEYTLEVLKNTLKNPSREQLMQRIMAQTARTDL 61 Query 63 ASAAELVDEAR 73 E++ E R Sbjct 62 PPMVEVLQEGR 72 >gi|50843516|ref|YP_056743.1| hypothetical protein PPA2075 [Propionibacterium acnes KPA171202] gi|282854838|ref|ZP_06264172.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix domain protein [Propionibacterium acnes J139] gi|289426094|ref|ZP_06427841.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix domain protein [Propionibacterium acnes SK187] 71 more sequence titles Length=75 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 28/71 (40%), Positives = 40/71 (57%), Gaps = 0/71 (0%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLG 62 A +QIRNVP+E ELKARAA Q SLS++ L L + P+ + ++ R+ A R Sbjct 2 ATIQIRNVPEETSRELKARAALQGKSLSEYTLEVLQNTLKNPSREQLMQRIMAQTARTDL 61 Query 63 ASAAELVDEAR 73 E++ E R Sbjct 62 PPMVEVLQEGR 72 >gi|284992099|ref|YP_003410653.1| hypothetical protein Gobs_3699 [Geodermatophilus obscurus DSM 43160] gi|284065344|gb|ADB76282.1| conserved hypothetical protein [Geodermatophilus obscurus DSM 43160] Length=73 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 26/53 (50%), Positives = 36/53 (68%), Gaps = 0/53 (0%) Query 4 MVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAAL 56 M+Q+RNVPD+L EL+ RAA MSLSD++L L +AE + +V R AA+ Sbjct 1 MLQVRNVPDDLHAELRRRAAEAGMSLSDYVLRELRRVAERSPMAEVFARSAAM 53 >gi|269957932|ref|YP_003327721.1| hypothetical protein Xcel_3162 [Xylanimonas cellulosilytica DSM 15894] gi|269306613|gb|ACZ32163.1| conserved hypothetical protein [Xylanimonas cellulosilytica DSM 15894] Length=77 Score = 48.1 bits (113), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 26/72 (37%), Positives = 46/72 (64%), Gaps = 0/72 (0%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLG 62 + +Q+RNVPD++ LK RAA SLS+++LA+L +A+ P +D++ R+ R LG Sbjct 2 STLQVRNVPDDVGRVLKQRAARAGQSLSEYVLAQLRALADRPTIDELNARIETRGRVSLG 61 Query 63 ASAAELVDEARS 74 A+++ +R+ Sbjct 62 IDTADVLAASRA 73 >gi|152966079|ref|YP_001361863.1| hypothetical protein Krad_2114 [Kineococcus radiotolerans SRS30216] gi|151360596|gb|ABS03599.1| conserved hypothetical protein [Kineococcus radiotolerans SRS30216] Length=76 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 25/51 (50%), Positives = 33/51 (65%), Gaps = 0/51 (0%) Query 5 VQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAA 55 VQI++VPDE L+ RAA SL ++LLA+L E A P LD+VL+R Sbjct 4 VQIKDVPDETHTVLRRRAALAHQSLQEYLLAKLVEEASTPTLDEVLERAGG 54 >gi|327335218|gb|EGE76928.1| conserved domain protein [Propionibacterium acnes HL097PA1] Length=75 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/71 (39%), Positives = 39/71 (55%), Gaps = 0/71 (0%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLG 62 A +QIRNVP+E LKARAA Q SLS++ L L + P+ + ++ R+ A R Sbjct 2 ATIQIRNVPEETSRGLKARAALQGKSLSEYTLEVLQNTLKNPSREQLMQRIMAQTARTDL 61 Query 63 ASAAELVDEAR 73 E++ E R Sbjct 62 PPMVEVLQEGR 72 >gi|314928788|gb|EFS92619.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix fold domain protein [Propionibacterium acnes HL044PA1] gi|314971176|gb|EFT15274.1| toxin-antitoxin system, antitoxin component, ribbon-helix-helix fold domain protein [Propionibacterium acnes HL037PA3] Length=57 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%) Query 4 MVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEE 43 +QIRNVP+E ELKARAA Q SLS++ L L E +E Sbjct 3 TIQIRNVPEETSRELKARAALQGKSLSEYTLEVLTEHTQE 42 >gi|312195769|ref|YP_004015830.1| hypothetical protein FraEuI1c_1909 [Frankia sp. EuI1c] gi|311227105|gb|ADP79960.1| hypothetical protein FraEuI1c_1909 [Frankia sp. EuI1c] Length=105 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 22/52 (43%), Positives = 34/52 (66%), Gaps = 0/52 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDR 52 M + IRNVP+E+ EL ARAA SL +++L +L ++A +P +DV+ R Sbjct 28 MVVALTIRNVPEEIRDELAARAARSGRSLQEYVLRQLIDLASQPTAEDVIAR 79 >gi|315446138|ref|YP_004079017.1| hypothetical protein Mspyr1_46320 [Mycobacterium sp. Spyr1] gi|315264441|gb|ADU01183.1| hypothetical protein Mspyr1_46320 [Mycobacterium sp. Spyr1] Length=76 Score = 42.4 bits (98), Expect = 0.027, Method: Compositional matrix adjust. Identities = 28/71 (40%), Positives = 41/71 (58%), Gaps = 2/71 (2%) Query 5 VQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLGAS 64 VQI++VPD+ L+ RAA SL ++L +RL A +P ++V +R A + S Sbjct 4 VQIKDVPDDTHRVLRERAARAHQSLQEYLRSRLIAEASQPTAEEVFERAAVRKGGKVSFS 63 Query 65 AAELVDEARSE 75 AA VDE R+E Sbjct 64 AA--VDEIRAE 72 >gi|333025633|ref|ZP_08453697.1| hypothetical protein STTU_3137 [Streptomyces sp. Tu6071] gi|332745485|gb|EGJ75926.1| hypothetical protein STTU_3137 [Streptomyces sp. Tu6071] Length=75 Score = 40.8 bits (94), Expect = 0.063, Method: Compositional matrix adjust. Identities = 23/52 (45%), Positives = 33/52 (64%), Gaps = 0/52 (0%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLA 54 A VQIRN+ DE L+ RAA SL ++L + E+A P++D+VLD L+ Sbjct 2 ATVQIRNLDDEAYAILRRRAAESGRSLQEYLRIEVEELARRPSMDEVLDDLS 53 >gi|284992068|ref|YP_003410622.1| hypothetical protein Gobs_3667 [Geodermatophilus obscurus DSM 43160] gi|284065313|gb|ADB76251.1| conserved hypothetical protein [Geodermatophilus obscurus DSM 43160] Length=78 Score = 40.4 bits (93), Expect = 0.085, Method: Compositional matrix adjust. Identities = 22/54 (41%), Positives = 32/54 (60%), Gaps = 0/54 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLA 54 M+ V IRNVP+E L ARAA SL +++ +L +A P D++ DR+A Sbjct 1 MAVSVTIRNVPEETRDVLAARAARAGQSLQEYVRGQLTALARRPDPDELWDRVA 54 >gi|134102275|ref|YP_001107936.1| hypothetical protein SACE_5827 [Saccharopolyspora erythraea NRRL 2338] gi|291003762|ref|ZP_06561735.1| hypothetical protein SeryN2_04502 [Saccharopolyspora erythraea NRRL 2338] gi|133914898|emb|CAM05011.1| hypothetical protein SACE_5827 [Saccharopolyspora erythraea NRRL 2338] Length=76 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 20/53 (38%), Positives = 31/53 (59%), Gaps = 0/53 (0%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRL 53 M +VQIR+VP+++ LK RA S S+FL L + A P + +++ RL Sbjct 1 MGVLVQIRDVPEDVYRTLKIRAVEAGQSYSEFLRGLLTQAASRPPMAEMVRRL 53 >gi|336118170|ref|YP_004572939.1| hypothetical protein MLP_25220 [Microlunatus phosphovorus NM-1] gi|334685951|dbj|BAK35536.1| hypothetical protein MLP_25220 [Microlunatus phosphovorus NM-1] Length=76 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%) Query 5 VQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDR 52 VQI++VP+E L+ RAA SL ++LL +L E A P + +VL R Sbjct 4 VQIKDVPEETHRVLRRRAAEAHQSLQEYLLTKLVEDARVPTMAEVLRR 51 >gi|218295255|ref|ZP_03496091.1| conserved hypothetical protein [Thermus aquaticus Y51MC23] gi|218244458|gb|EED10983.1| conserved hypothetical protein [Thermus aquaticus Y51MC23] Length=77 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 30/75 (40%), Positives = 46/75 (62%), Gaps = 7/75 (9%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALD--DVLDRLAALPRRD 60 + +Q++ VP++L L +A A+ +SLS+F+L L E ALD + +RLA D Sbjct 2 STLQVKKVPEDLKARLVRQARARGLSLSEFVLEAL-----ERALDEAEWRERLAQRAPVD 56 Query 61 LGASAAELVDEARSE 75 LG AA+L++EAR E Sbjct 57 LGLPAAKLLEEAREE 71 >gi|271964588|ref|YP_003338784.1| hypothetical protein Sros_3093 [Streptosporangium roseum DSM 43021] gi|270507763|gb|ACZ86041.1| hypothetical protein Sros_3093 [Streptosporangium roseum DSM 43021] Length=71 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/51 (44%), Positives = 31/51 (61%), Gaps = 0/51 (0%) Query 5 VQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAA 55 +QIR+VPD LKARA SL+ ++ L E A P LD+V+ ++AA Sbjct 1 MQIRDVPDATERTLKARAERDGKSLTAYVRDLLNEEAATPTLDEVMAKIAA 51 >gi|84494960|ref|ZP_00994079.1| O-succinylbenzoate synthase [Janibacter sp. HTCC2649] gi|84384453|gb|EAQ00333.1| O-succinylbenzoate synthase [Janibacter sp. HTCC2649] Length=78 Score = 35.4 bits (80), Expect = 3.0, Method: Compositional matrix adjust. Identities = 24/77 (32%), Positives = 43/77 (56%), Gaps = 6/77 (7%) Query 3 AMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALD----DVLDRLAALPR 58 A +Q++NVPD+L +KARA + +++SD +L L P+ + +V +R + Sbjct 2 ATLQVKNVPDDLYAAVKARAVREHLTVSDLVLRNLRREVALPSRNEWIAEVTERAETVRG 61 Query 59 RDLGASAAELVDEARSE 75 R + + +VDE R+E Sbjct 62 RRIDVQS--VVDEVRAE 76 >gi|312194111|ref|YP_004014172.1| hypothetical protein FraEuI1c_0214 [Frankia sp. EuI1c] gi|311225447|gb|ADP78302.1| hypothetical protein FraEuI1c_0214 [Frankia sp. EuI1c] Length=66 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/44 (41%), Positives = 27/44 (62%), Gaps = 0/44 (0%) Query 10 VPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRL 53 +PD++ L+ A A L ++LLA LA I P +D+VLDR+ Sbjct 1 MPDDVFRRLRELAEAADRPLEEYLLAELARITATPTMDEVLDRI 44 >gi|227832925|ref|YP_002834632.1| hypothetical protein cauri_1101 [Corynebacterium aurimucosum ATCC 700975] gi|262182586|ref|ZP_06042007.1| hypothetical protein CaurA7_01215 [Corynebacterium aurimucosum ATCC 700975] gi|227453941|gb|ACP32694.1| hypothetical protein cauri_1101 [Corynebacterium aurimucosum ATCC 700975] Length=92 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 19/53 (36%), Positives = 34/53 (65%), Gaps = 0/53 (0%) Query 2 SAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLA 54 + VQIR+V +++ LK RA + +SLS +L L ++A P+L++ L+ L+ Sbjct 16 TTNVQIRDVNTDVVDILKMRADRKGISLSSYLRETLEKVASRPSLEEKLEELS 68 >gi|337766708|emb|CCB75419.1| conserved protein of unknown function [Streptomyces cattleya NRRL 8057] Length=76 Score = 33.9 bits (76), Expect = 8.7, Method: Compositional matrix adjust. Identities = 26/79 (33%), Positives = 43/79 (55%), Gaps = 10/79 (12%) Query 1 MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRL-----AA 55 M+A+ IR+VPD+ + LK RAA SL + L +A +P + +++ RL A Sbjct 1 MTALT-IRDVPDDQIQTLKVRAAQAGKSLQAYFLDLIARETSKPTMAEMVARLNRETTAG 59 Query 56 LPRRDLGASAAELVDEARS 74 + D+ A+ +DEAR+ Sbjct 60 VSTEDVLAA----IDEART 74 Lambda K H 0.317 0.130 0.335 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131059142040 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40