BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv1799 Length=63 Score E Sequences producing significant alignments: (Bits) Value gi|15608936|ref|NP_216315.1| lipoprotein LppT [Mycobacterium tub... 122 2e-26 >gi|15608936|ref|NP_216315.1| lipoprotein LppT [Mycobacterium tuberculosis H37Rv] gi|15841268|ref|NP_336305.1| hypothetical protein MT1848 [Mycobacterium tuberculosis CDC1551] gi|31792987|ref|NP_855480.1| lipoprotein LppT [Mycobacterium bovis AF2122/97] 56 more sequence titlesLength=63 Score = 122 bits (305), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%) Query 1 MSVKSKNGRLAARVLVALAALFAMIALTGSACLAEGPPLGRNPQGAPAPVGGTVIVAPMH 60 MSVKSKNGRLAARVLVALAALFAMIALTGSACLAEGPPLGRNPQGAPAPVGGTVIVAPMH Sbjct 1 MSVKSKNGRLAARVLVALAALFAMIALTGSACLAEGPPLGRNPQGAPAPVGGTVIVAPMH 60 Query 61 SGV 63 SGV Sbjct 61 SGV 63 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131230491224 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40