BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2049c Length=74 Score E Sequences producing significant alignments: (Bits) Value gi|167970422|ref|ZP_02552699.1| hypothetical protein MtubH3_2126... 138 3e-31 gi|15609186|ref|NP_216565.1| hypothetical protein Rv2049c [Mycob... 138 3e-31 gi|15841537|ref|NP_336574.1| hypothetical protein MT2109 [Mycoba... 137 5e-31 gi|308369606|ref|ZP_07418411.2| hypothetical protein TMBG_00595 ... 137 6e-31 gi|296165138|ref|ZP_06847688.1| conserved hypothetical protein [... 112 3e-23 gi|118617786|ref|YP_906118.1| hypothetical protein MUL_2267 [Myc... 111 3e-23 gi|254822172|ref|ZP_05227173.1| hypothetical protein MintA_19714... 108 2e-22 gi|183983027|ref|YP_001851318.1| hypothetical protein MMAR_3026 ... 108 2e-22 gi|118466783|ref|YP_881641.1| hypothetical protein MAV_2448 [Myc... 106 1e-21 gi|342859765|ref|ZP_08716418.1| hypothetical protein MCOL_12828 ... 106 1e-21 gi|41407895|ref|NP_960731.1| hypothetical protein MAP1797c [Myco... 106 1e-21 gi|240173209|ref|ZP_04751867.1| hypothetical protein MkanA1_2810... 105 2e-21 gi|169629301|ref|YP_001702950.1| hypothetical protein MAB_2215 [... 94.0 8e-18 gi|120404389|ref|YP_954218.1| hypothetical protein Mvan_3416 [My... 89.0 2e-16 gi|315444035|ref|YP_004076914.1| hypothetical protein Mspyr1_243... 87.4 6e-16 gi|145223707|ref|YP_001134385.1| hypothetical protein Mflv_3120 ... 87.4 7e-16 gi|108799472|ref|YP_639669.1| hypothetical protein Mmcs_2505 [My... 86.3 2e-15 gi|118472162|ref|YP_888148.1| hypothetical protein MSMEG_3857 [M... 85.5 2e-15 gi|336462064|gb|EGO40909.1| hypothetical protein MAPs_24450 [Myc... 84.3 6e-15 gi|333990739|ref|YP_004523353.1| hypothetical protein JDM601_209... 72.4 2e-11 gi|229493553|ref|ZP_04387338.1| conserved hypothetical protein [... 68.6 3e-10 gi|226306611|ref|YP_002766571.1| hypothetical protein RER_31240 ... 67.0 9e-10 gi|257055984|ref|YP_003133816.1| hypothetical protein Svir_19710... 63.5 9e-09 gi|312139779|ref|YP_004007115.1| hypothetical protein REQ_23890 ... 62.8 2e-08 gi|134098861|ref|YP_001104522.1| hypothetical protein SACE_2293 ... 61.6 3e-08 gi|291005781|ref|ZP_06563754.1| hypothetical protein SeryN2_1477... 61.6 4e-08 gi|300786600|ref|YP_003766891.1| hypothetical protein AMED_4723 ... 60.8 6e-08 gi|302527363|ref|ZP_07279705.1| conserved hypothetical protein [... 60.1 1e-07 gi|225021480|ref|ZP_03710672.1| hypothetical protein CORMATOL_01... 59.7 1e-07 gi|227549303|ref|ZP_03979352.1| conserved hypothetical protein [... 58.5 3e-07 gi|337290696|ref|YP_004629717.1| hypothetical protein CULC22_010... 58.2 4e-07 gi|62390360|ref|YP_225762.1| hypothetical protein cg1670 [Coryne... 58.2 4e-07 gi|111017164|ref|YP_700136.1| hypothetical protein RHA1_ro00142 ... 57.8 6e-07 gi|226359673|ref|YP_002777451.1| hypothetical protein ROP_02590 ... 57.4 7e-07 gi|326382308|ref|ZP_08204000.1| hypothetical protein SCNU_05181 ... 57.0 8e-07 gi|262202414|ref|YP_003273622.1| hypothetical protein Gbro_2488 ... 57.0 9e-07 gi|25028160|ref|NP_738214.1| hypothetical protein CE1604 [Coryne... 56.6 1e-06 gi|302206148|gb|ADL10490.1| Hypothetical protein CpC231_1013 [Co... 56.2 2e-06 gi|302330705|gb|ADL20899.1| Hypothetical protein Cp1002_1014 [Co... 55.8 2e-06 gi|54025082|ref|YP_119324.1| hypothetical protein nfa31130 [Noca... 55.5 3e-06 gi|296139907|ref|YP_003647150.1| hypothetical protein Tpau_2202 ... 55.5 3e-06 gi|333919730|ref|YP_004493311.1| hypothetical protein AS9A_2062 ... 54.7 4e-06 gi|38233812|ref|NP_939579.1| hypothetical protein DIP1224 [Coryn... 54.3 5e-06 gi|255325676|ref|ZP_05366773.1| conserved hypothetical protein [... 54.3 6e-06 gi|343927912|ref|ZP_08767378.1| hypothetical protein GOALK_099_0... 53.9 7e-06 gi|259507219|ref|ZP_05750119.1| conserved hypothetical protein [... 52.8 2e-05 gi|340794372|ref|YP_004759835.1| hypothetical protein CVAR_1408 ... 52.0 3e-05 gi|296117869|ref|ZP_06836452.1| conserved hypothetical protein [... 52.0 3e-05 gi|145295611|ref|YP_001138432.1| hypothetical protein cgR_1538 [... 50.4 8e-05 gi|334564301|ref|ZP_08517292.1| hypothetical protein CbovD2_0698... 50.4 1e-04 >gi|167970422|ref|ZP_02552699.1| hypothetical protein MtubH3_21268 [Mycobacterium tuberculosis H37Ra] gi|313658947|ref|ZP_07815827.1| hypothetical protein MtubKV_11021 [Mycobacterium tuberculosis KZN V2475] gi|323719344|gb|EGB28483.1| hypothetical protein TMMG_01323 [Mycobacterium tuberculosis CDC1551A] gi|339294976|gb|AEJ47087.1| hypothetical protein CCDC5079_1897 [Mycobacterium tuberculosis CCDC5079] gi|339298602|gb|AEJ50712.1| hypothetical protein CCDC5180_1875 [Mycobacterium tuberculosis CCDC5180] Length=100 Score = 138 bits (347), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%) Query 1 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI Sbjct 27 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 86 Query 61 RAARAADGWRRAGA 74 RAARAADGWRRAGA Sbjct 87 RAARAADGWRRAGA 100 >gi|15609186|ref|NP_216565.1| hypothetical protein Rv2049c [Mycobacterium tuberculosis H37Rv] gi|31793232|ref|NP_855725.1| hypothetical protein Mb2075c [Mycobacterium bovis AF2122/97] gi|121637935|ref|YP_978158.1| hypothetical protein BCG_2068c [Mycobacterium bovis BCG str. Pasteur 1173P2] 27 more sequence titles Length=74 Score = 138 bits (347), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%) Query 1 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI Sbjct 1 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 Query 61 RAARAADGWRRAGA 74 RAARAADGWRRAGA Sbjct 61 RAARAADGWRRAGA 74 >gi|15841537|ref|NP_336574.1| hypothetical protein MT2109 [Mycobacterium tuberculosis CDC1551] gi|148823265|ref|YP_001288019.1| hypothetical protein TBFG_12086 [Mycobacterium tuberculosis F11] gi|253798894|ref|YP_003031895.1| hypothetical protein TBMG_01932 [Mycobacterium tuberculosis KZN 1435] 31 more sequence titles Length=120 Score = 137 bits (346), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%) Query 1 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI Sbjct 47 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 106 Query 61 RAARAADGWRRAGA 74 RAARAADGWRRAGA Sbjct 107 RAARAADGWRRAGA 120 >gi|308369606|ref|ZP_07418411.2| hypothetical protein TMBG_00595 [Mycobacterium tuberculosis SUMu002] gi|308370902|ref|ZP_07423143.2| hypothetical protein TMCG_00144 [Mycobacterium tuberculosis SUMu003] gi|308372132|ref|ZP_07427505.2| hypothetical protein TMDG_00528 [Mycobacterium tuberculosis SUMu004] 7 more sequence titles Length=116 Score = 137 bits (344), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%) Query 1 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI Sbjct 43 MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 102 Query 61 RAARAADGWRRAGA 74 RAARAADGWRRAGA Sbjct 103 RAARAADGWRRAGA 116 >gi|296165138|ref|ZP_06847688.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295899506|gb|EFG78962.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=97 Score = 112 bits (279), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 62/74 (84%), Positives = 64/74 (87%), Gaps = 2/74 (2%) Query 2 LTRG--EVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDEL 59 LTRG ALP DAVVLSADDA DLSDRVYQVRCAAEDV TAL+EGA ATELR+LCD L Sbjct 23 LTRGGGSAPALPPDAVVLSADDAVDLSDRVYQVRCAAEDVATALEEGAQATELRELCDVL 82 Query 60 IRAARAADGWRRAG 73 IRAARAADGWRRAG Sbjct 83 IRAARAADGWRRAG 96 >gi|118617786|ref|YP_906118.1| hypothetical protein MUL_2267 [Mycobacterium ulcerans Agy99] gi|118569896|gb|ABL04647.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] Length=119 Score = 111 bits (278), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 61/76 (81%), Positives = 67/76 (89%), Gaps = 3/76 (3%) Query 1 MLTRGEVRA---LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCD 57 M+TRG+ A LPADAVVLSAD+AADLSDRVYQVRCAAEDV TALDEGA+ ELR+LCD Sbjct 43 MMTRGDAGAALALPADAVVLSADEAADLSDRVYQVRCAAEDVATALDEGASVDELRELCD 102 Query 58 ELIRAARAADGWRRAG 73 EL+RAARAADGWRR G Sbjct 103 ELLRAARAADGWRRVG 118 >gi|254822172|ref|ZP_05227173.1| hypothetical protein MintA_19714 [Mycobacterium intracellulare ATCC 13950] Length=95 Score = 108 bits (271), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 59/72 (82%), Positives = 61/72 (85%), Gaps = 0/72 (0%) Query 2 LTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIR 61 L R A+P DAVVLSADDAADLSDRVYQVRCAAEDV TAL+EGA ATELR LCD LI Sbjct 23 LNRHGAAAVPDDAVVLSADDAADLSDRVYQVRCAAEDVATALEEGAEATELRQLCDALIH 82 Query 62 AARAADGWRRAG 73 AARAADGWRRAG Sbjct 83 AARAADGWRRAG 94 >gi|183983027|ref|YP_001851318.1| hypothetical protein MMAR_3026 [Mycobacterium marinum M] gi|183176353|gb|ACC41463.1| conserved hypothetical protein [Mycobacterium marinum M] Length=76 Score = 108 bits (271), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 3/75 (4%) Query 2 LTRGEVRA---LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDE 58 +TRG+ A LPAD+VVLSAD+AADLSDRVYQVRCAAEDV TALDEGA ELR+LCDE Sbjct 1 MTRGDAGAALALPADSVVLSADEAADLSDRVYQVRCAAEDVATALDEGAGVDELRELCDE 60 Query 59 LIRAARAADGWRRAG 73 L+RAARAADGWRR G Sbjct 61 LLRAARAADGWRRVG 75 >gi|118466783|ref|YP_881641.1| hypothetical protein MAV_2448 [Mycobacterium avium 104] gi|254775108|ref|ZP_05216624.1| hypothetical protein MaviaA2_10621 [Mycobacterium avium subsp. avium ATCC 25291] gi|118168070|gb|ABK68967.1| conserved hypothetical protein [Mycobacterium avium 104] Length=95 Score = 106 bits (265), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 57/72 (80%), Positives = 60/72 (84%), Gaps = 0/72 (0%) Query 2 LTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIR 61 L R A+P DAVVLSADDAADLSDRVYQVRCAAEDV TA+DEGA ELR LCD LI+ Sbjct 23 LNRHGAAAVPEDAVVLSADDAADLSDRVYQVRCAAEDVATAVDEGAGPAELRQLCDALIQ 82 Query 62 AARAADGWRRAG 73 AARAADGWRRAG Sbjct 83 AARAADGWRRAG 94 >gi|342859765|ref|ZP_08716418.1| hypothetical protein MCOL_12828 [Mycobacterium colombiense CECT 3035] gi|342132897|gb|EGT86117.1| hypothetical protein MCOL_12828 [Mycobacterium colombiense CECT 3035] Length=94 Score = 106 bits (265), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 55/64 (86%), Positives = 59/64 (93%), Gaps = 0/64 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGW 69 +P DAVVLSA+DAADLSDRVYQVRCAAEDV TA+DEGA ATELR LCD LI+AARAADGW Sbjct 30 VPEDAVVLSAEDAADLSDRVYQVRCAAEDVATAVDEGAGATELRQLCDALIQAARAADGW 89 Query 70 RRAG 73 RRAG Sbjct 90 RRAG 93 >gi|41407895|ref|NP_960731.1| hypothetical protein MAP1797c [Mycobacterium avium subsp. paratuberculosis K-10] gi|41396249|gb|AAS04114.1| hypothetical protein MAP_1797c [Mycobacterium avium subsp. paratuberculosis K-10] Length=116 Score = 106 bits (264), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 57/72 (80%), Positives = 60/72 (84%), Gaps = 0/72 (0%) Query 2 LTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIR 61 L R A+P DAVVLSADDAADLSDRVYQVRCAAEDV TA+DEGA ELR LCD LI+ Sbjct 44 LNRHGAAAVPEDAVVLSADDAADLSDRVYQVRCAAEDVATAVDEGAGPAELRQLCDALIQ 103 Query 62 AARAADGWRRAG 73 AARAADGWRRAG Sbjct 104 AARAADGWRRAG 115 >gi|240173209|ref|ZP_04751867.1| hypothetical protein MkanA1_28101 [Mycobacterium kansasii ATCC 12478] Length=103 Score = 105 bits (263), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 3/76 (3%) Query 1 MLTRGEVRA---LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCD 57 M+TRG+ A LPADAVVL+AD+AADLSDR+YQVRCAAED+ ALDEGA A ELR+LC+ Sbjct 27 MMTRGDAGASLALPADAVVLTADEAADLSDRIYQVRCAAEDIGLALDEGAGAAELRELCE 86 Query 58 ELIRAARAADGWRRAG 73 L+RAARAADGWRR G Sbjct 87 GLLRAARAADGWRRVG 102 >gi|169629301|ref|YP_001702950.1| hypothetical protein MAB_2215 [Mycobacterium abscessus ATCC 19977] gi|169241268|emb|CAM62296.1| Conserved hypothetical protein [Mycobacterium abscessus] Length=109 Score = 94.0 bits (232), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 46/62 (75%), Positives = 56/62 (91%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PADAVVL+AD+AADL+DRVYQ RCAAEDV TA++EGA ELR LC+EL+RAA+AADG Sbjct 48 SVPADAVVLTADEAADLADRVYQARCAAEDVATAVEEGATQDELRQLCEELLRAAKAADG 107 Query 69 WR 70 WR Sbjct 108 WR 109 >gi|120404389|ref|YP_954218.1| hypothetical protein Mvan_3416 [Mycobacterium vanbaalenii PYR-1] gi|119957207|gb|ABM14212.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] Length=116 Score = 89.0 bits (219), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 44/62 (71%), Positives = 54/62 (88%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++P DAVVLSA++A++LSDRVYQVRCAAED+ TAL EGA ELR LCD +++AARAADG Sbjct 55 SVPPDAVVLSAEEASELSDRVYQVRCAAEDMATALQEGADPAELRALCDAVMQAARAADG 114 Query 69 WR 70 WR Sbjct 115 WR 116 >gi|315444035|ref|YP_004076914.1| hypothetical protein Mspyr1_24370 [Mycobacterium sp. Spyr1] gi|315262338|gb|ADT99079.1| hypothetical protein Mspyr1_24370 [Mycobacterium sp. Spyr1] Length=116 Score = 87.4 bits (215), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++P DAVVLSA++A+ L+DRVYQVRCAAED+ TALDEGA ELR+LCD +++AARAADG Sbjct 55 SVPEDAVVLSAEEASVLADRVYQVRCAAEDMATALDEGADRAELRELCDAVMQAARAADG 114 Query 69 WR 70 WR Sbjct 115 WR 116 >gi|145223707|ref|YP_001134385.1| hypothetical protein Mflv_3120 [Mycobacterium gilvum PYR-GCK] gi|145216193|gb|ABP45597.1| conserved hypothetical protein [Mycobacterium gilvum PYR-GCK] Length=93 Score = 87.4 bits (215), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++P DAVVLSA++A+ L+DRVYQVRCAAED+ TALDEGA ELR+LCD +++AARAADG Sbjct 32 SVPEDAVVLSAEEASVLADRVYQVRCAAEDMATALDEGADRAELRELCDAVMQAARAADG 91 Query 69 WR 70 WR Sbjct 92 WR 93 >gi|108799472|ref|YP_639669.1| hypothetical protein Mmcs_2505 [Mycobacterium sp. MCS] gi|119868585|ref|YP_938537.1| hypothetical protein Mkms_2550 [Mycobacterium sp. KMS] gi|126435126|ref|YP_001070817.1| hypothetical protein Mjls_2542 [Mycobacterium sp. JLS] gi|108769891|gb|ABG08613.1| conserved hypothetical protein [Mycobacterium sp. MCS] gi|119694674|gb|ABL91747.1| conserved hypothetical protein [Mycobacterium sp. KMS] gi|126234926|gb|ABN98326.1| conserved hypothetical protein [Mycobacterium sp. JLS] Length=123 Score = 86.3 bits (212), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 44/62 (71%), Positives = 54/62 (88%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 +L DAVVL+A++AA L+DRV++VRCAAEDV TA+DEGA + ELR LCD L+RAARAADG Sbjct 62 SLSPDAVVLTAEEAALLADRVFEVRCAAEDVATAVDEGAGSDELRQLCDALMRAARAADG 121 Query 69 WR 70 WR Sbjct 122 WR 123 >gi|118472162|ref|YP_888148.1| hypothetical protein MSMEG_3857 [Mycobacterium smegmatis str. MC2 155] gi|118173449|gb|ABK74345.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2 155] Length=117 Score = 85.5 bits (210), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 43/62 (70%), Positives = 51/62 (83%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 +L D+VVL+A++AA LSDRVYQVRCAAEDV A+DEGA ELR LCD L+ AA+AADG Sbjct 56 SLAPDSVVLTAEEAAQLSDRVYQVRCAAEDVAIAVDEGAEPHELRQLCDALLEAAKAADG 115 Query 69 WR 70 WR Sbjct 116 WR 117 >gi|336462064|gb|EGO40909.1| hypothetical protein MAPs_24450 [Mycobacterium avium subsp. paratuberculosis S397] Length=92 Score = 84.3 bits (207), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 56/72 (78%), Positives = 60/72 (84%), Gaps = 3/72 (4%) Query 2 LTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIR 61 L R A+P DAVVLSADDAADL+DRVYQVRCAAEDV TA+DEGA ELR LCD LI+ Sbjct 23 LNRHGAAAVPEDAVVLSADDAADLADRVYQVRCAAEDVATAVDEGA---ELRQLCDALIQ 79 Query 62 AARAADGWRRAG 73 AARAADGWRRAG Sbjct 80 AARAADGWRRAG 91 >gi|333990739|ref|YP_004523353.1| hypothetical protein JDM601_2099 [Mycobacterium sp. JDM601] gi|333486707|gb|AEF36099.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=62 Score = 72.4 bits (176), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 38/61 (63%), Positives = 46/61 (76%), Gaps = 0/61 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGW 69 L D+VVLSA++A LSDRVYQVRCAAED+ TAL E A ELR LC+ L++A +AD W Sbjct 2 LAPDSVVLSAEEATALSDRVYQVRCAAEDIATALAEDAPHDELRQLCEALLQAVESADRW 61 Query 70 R 70 R Sbjct 62 R 62 >gi|229493553|ref|ZP_04387338.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|229319514|gb|EEN85350.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length=99 Score = 68.6 bits (166), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 33/62 (54%), Positives = 48/62 (78%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PADAV+L+A +A +L DR+++VRCAAEDV TA+ EGA ++EL LC+ L AR A+ Sbjct 38 SIPADAVILTAVEAVELVDRMFEVRCAAEDVATAIAEGAESSELTQLCERLTELAREAER 97 Query 69 WR 70 +R Sbjct 98 FR 99 >gi|226306611|ref|YP_002766571.1| hypothetical protein RER_31240 [Rhodococcus erythropolis PR4] gi|226185728|dbj|BAH33832.1| conserved hypothetical protein [Rhodococcus erythropolis PR4] Length=118 Score = 67.0 bits (162), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 33/61 (55%), Positives = 47/61 (78%), Gaps = 0/61 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGW 69 +PADAV+L+A +A +L DR+++VRCAAEDV TA+ EGA ++EL LC+ L AR A+ + Sbjct 58 IPADAVILTAVEAVELVDRMFEVRCAAEDVATAVAEGAESSELAQLCERLTELAREAERF 117 Query 70 R 70 R Sbjct 118 R 118 >gi|257055984|ref|YP_003133816.1| hypothetical protein Svir_19710 [Saccharomonospora viridis DSM 43017] gi|256585856|gb|ACU96989.1| hypothetical protein Svir_19710 [Saccharomonospora viridis DSM 43017] Length=144 Score = 63.5 bits (153), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAA 63 LP DAVVLS + A L DR++Q+RCAAEDV TA EGA A ELR L DEL R A Sbjct 83 GLPTDAVVLSRSEIAALQDRLFQLRCAAEDVATAAREGADAQELRMLADELARTA 137 >gi|312139779|ref|YP_004007115.1| hypothetical protein REQ_23890 [Rhodococcus equi 103S] gi|325676767|ref|ZP_08156440.1| hypothetical protein HMPREF0724_14223 [Rhodococcus equi ATCC 33707] gi|311889118|emb|CBH48431.1| conserved hypothetical protein [Rhodococcus equi 103S] gi|325552315|gb|EGD22004.1| hypothetical protein HMPREF0724_14223 [Rhodococcus equi ATCC 33707] Length=99 Score = 62.8 bits (151), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 33/62 (54%), Positives = 47/62 (76%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PADAVVLS ++A+ LSDR++++RCAAEDV TA+ EGA EL L + L+ AR A+ Sbjct 38 SIPADAVVLSVEEASALSDRLFELRCAAEDVATAVAEGAEGRELSALTERLVAMARDAER 97 Query 69 WR 70 +R Sbjct 98 FR 99 >gi|134098861|ref|YP_001104522.1| hypothetical protein SACE_2293 [Saccharopolyspora erythraea NRRL 2338] gi|133911484|emb|CAM01597.1| hypothetical protein SACE_2293 [Saccharopolyspora erythraea NRRL 2338] Length=116 Score = 61.6 bits (148), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 30/51 (59%), Positives = 42/51 (83%), Gaps = 0/51 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 LP DAVVLSA + A+L DR++Q+RCAAEDVVTA ++GA+A ELR + +++ Sbjct 56 LPEDAVVLSAAELANLQDRLFQLRCAAEDVVTAAEDGASAEELRKMAAQVV 106 >gi|291005781|ref|ZP_06563754.1| hypothetical protein SeryN2_14773 [Saccharopolyspora erythraea NRRL 2338] Length=83 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/51 (59%), Positives = 42/51 (83%), Gaps = 0/51 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 LP DAVVLSA + A+L DR++Q+RCAAEDVVTA ++GA+A ELR + +++ Sbjct 23 LPEDAVVLSAAELANLQDRLFQLRCAAEDVVTAAEDGASAEELRKMAAQVV 73 >gi|300786600|ref|YP_003766891.1| hypothetical protein AMED_4723 [Amycolatopsis mediterranei U32] gi|299796114|gb|ADJ46489.1| conserved hypothetical protein [Amycolatopsis mediterranei U32] gi|340528083|gb|AEK43288.1| hypothetical protein RAM_24040 [Amycolatopsis mediterranei S699] Length=126 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 33/56 (59%), Positives = 41/56 (74%), Gaps = 0/56 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAAR 64 LP DAVVLS + A L DR++Q+RCAAED+VTA D+GA ELR L E+ RAA+ Sbjct 65 GLPEDAVVLSDTEIAALQDRLFQLRCAAEDIVTAADDGADTRELRGLAAEIARAAK 120 >gi|302527363|ref|ZP_07279705.1| conserved hypothetical protein [Streptomyces sp. AA4] gi|302436258|gb|EFL08074.1| conserved hypothetical protein [Streptomyces sp. AA4] Length=118 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 31/56 (56%), Positives = 42/56 (75%), Gaps = 0/56 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAAR 64 LP DAVVLS + A L DR++Q+RCAAED+VTA +GA+A E+R L +E+ AA+ Sbjct 57 GLPEDAVVLSDTEIAALQDRLFQLRCAAEDIVTAAQDGASAGEMRQLAEEIAAAAK 112 >gi|225021480|ref|ZP_03710672.1| hypothetical protein CORMATOL_01500 [Corynebacterium matruchotii ATCC 33806] gi|224945862|gb|EEG27071.1| hypothetical protein CORMATOL_01500 [Corynebacterium matruchotii ATCC 33806] Length=124 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 25/61 (41%), Positives = 42/61 (69%), Gaps = 0/61 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGW 69 +PA+A++L + A L D ++++RCAAEDV TA++EGA + E+ LC+E + A + + Sbjct 61 IPAEAIILRPELAQRLQDSLFELRCAAEDVKTAVNEGATSAEITQLCNEFVALAHKTEKF 120 Query 70 R 70 R Sbjct 121 R 121 >gi|227549303|ref|ZP_03979352.1| conserved hypothetical protein [Corynebacterium lipophiloflavum DSM 44291] gi|227078622|gb|EEI16585.1| conserved hypothetical protein [Corynebacterium lipophiloflavum DSM 44291] Length=114 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 28/62 (46%), Positives = 44/62 (71%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PA AV+L+ + A DL D+++Q+RCAAED+ TA EGA E+ +LC+EL+ A+ + Sbjct 53 SIPAQAVILAPERADDLRDQLFQLRCAAEDIATAHREGADQREIAELCEELVSMAKRVER 112 Query 69 WR 70 R Sbjct 113 LR 114 >gi|337290696|ref|YP_004629717.1| hypothetical protein CULC22_01088 [Corynebacterium ulcerans BR-AD22] gi|334696809|gb|AEG81606.1| hypothetical protein CULC809_01073 [Corynebacterium ulcerans 809] gi|334699002|gb|AEG83798.1| hypothetical protein CULC22_01088 [Corynebacterium ulcerans BR-AD22] Length=108 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 A+P +AVVL + ++L D ++++RCAAED+ TA EGA TE++ LC EL+ A+ + Sbjct 47 AVPENAVVLRPERVSELRDSLFELRCAAEDIATASSEGADPTEMQQLCSELVVLAKQIEK 106 Query 69 WR 70 R Sbjct 107 LR 108 >gi|62390360|ref|YP_225762.1| hypothetical protein cg1670 [Corynebacterium glutamicum ATCC 13032] gi|41325697|emb|CAF21486.1| conserved hypothetical protein [Corynebacterium glutamicum ATCC 13032] Length=115 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 25/62 (41%), Positives = 44/62 (71%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PA+AV++S D A++L D ++++RCAAED+ TA++E A ++ LC E++ AR + Sbjct 54 SIPAEAVIMSPDRASELKDSLFELRCAAEDIATAVNEEEEARDIAKLCQEMVELARNIEK 113 Query 69 WR 70 R Sbjct 114 LR 115 >gi|111017164|ref|YP_700136.1| hypothetical protein RHA1_ro00142 [Rhodococcus jostii RHA1] gi|110816694|gb|ABG91978.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length=110 Score = 57.8 bits (138), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 35/62 (57%), Positives = 51/62 (83%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PADAVVL++++A+ + DRV+QVRCAAEDV TA+ EGAAA E+ LC +L++ AR A+ Sbjct 49 SIPADAVVLTSEEASAMVDRVFQVRCAAEDVATAVAEGAAAHEVESLCADLVQLAREAER 108 Query 69 WR 70 +R Sbjct 109 FR 110 >gi|226359673|ref|YP_002777451.1| hypothetical protein ROP_02590 [Rhodococcus opacus B4] gi|226238158|dbj|BAH48506.1| hypothetical protein [Rhodococcus opacus B4] Length=110 Score = 57.4 bits (137), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 37/69 (54%), Positives = 55/69 (80%), Gaps = 2/69 (2%) Query 4 RGEVR--ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIR 61 R +V+ ++PADAV+L+A++A+ + DRV+QVRCAAEDV TA+ EGAAA E+ LC +L++ Sbjct 42 RNQVKGTSIPADAVMLTAEEASAMVDRVFQVRCAAEDVATAVAEGAAAHEVESLCADLVQ 101 Query 62 AARAADGWR 70 AR A+ +R Sbjct 102 LAREAERFR 110 >gi|326382308|ref|ZP_08204000.1| hypothetical protein SCNU_05181 [Gordonia neofelifaecis NRRL B-59395] gi|326199038|gb|EGD56220.1| hypothetical protein SCNU_05181 [Gordonia neofelifaecis NRRL B-59395] Length=93 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 29/62 (47%), Positives = 43/62 (70%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++P DA++LS +AADL DR++ +RCAAED+ TAL E A + + DL E++R A A+ Sbjct 32 SIPEDAIILSPTEAADLGDRMFALRCAAEDLTTALGEKADRSTITDLAAEVLRLAHEAER 91 Query 69 WR 70 R Sbjct 92 LR 93 >gi|262202414|ref|YP_003273622.1| hypothetical protein Gbro_2488 [Gordonia bronchialis DSM 43247] gi|262085761|gb|ACY21729.1| hypothetical protein Gbro_2488 [Gordonia bronchialis DSM 43247] Length=93 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 A+PADA++LSA +AADL DR++ +RCAAED+ TAL E A L +L E++ AR A+ Sbjct 32 AIPADAIILSAAEAADLGDRLFALRCAAEDLDTALAEQADTATLTELAAEVVSLAREAEK 91 Query 69 WR 70 R Sbjct 92 LR 93 >gi|25028160|ref|NP_738214.1| hypothetical protein CE1604 [Corynebacterium efficiens YS-314] gi|23493444|dbj|BAC18414.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] Length=116 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 +P +AV+++ + A +L D ++++RCAAED+ TA+DEG A E+ LC EL+ AR + Sbjct 54 TIPVNAVIMTPERADELRDSLFELRCAAEDIATAVDEGENAREVTALCTELVELARRIEK 113 Query 69 WR 70 R Sbjct 114 LR 115 >gi|302206148|gb|ADL10490.1| Hypothetical protein CpC231_1013 [Corynebacterium pseudotuberculosis C231] gi|308276388|gb|ADO26287.1| Conserved hypothetical protein [Corynebacterium pseudotuberculosis I19] gi|341824827|gb|AEK92348.1| Hypothetical protein CpPAT10_1013 [Corynebacterium pseudotuberculosis PAT10] Length=108 Score = 56.2 bits (134), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 26/62 (42%), Positives = 41/62 (67%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 A+P +AVVL + ++L D ++++RCAAED+ TA EGA E++ LC EL+ A+ + Sbjct 47 AVPENAVVLRPERVSELRDSLFELRCAAEDIATASSEGADPMEMQQLCSELVVLAKQIEK 106 Query 69 WR 70 R Sbjct 107 LR 108 >gi|302330705|gb|ADL20899.1| Hypothetical protein Cp1002_1014 [Corynebacterium pseudotuberculosis 1002] Length=111 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 26/62 (42%), Positives = 41/62 (67%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 A+P +AVVL + ++L D ++++RCAAED+ TA EGA E++ LC EL+ A+ + Sbjct 50 AVPENAVVLRPERVSELRDSLFELRCAAEDIATASSEGADPMEMQQLCSELVVLAKQIEK 109 Query 69 WR 70 R Sbjct 110 LR 111 >gi|54025082|ref|YP_119324.1| hypothetical protein nfa31130 [Nocardia farcinica IFM 10152] gi|54016590|dbj|BAD57960.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=107 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 31/61 (51%), Positives = 41/61 (68%), Gaps = 0/61 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGW 69 +P D+V+LSA +AADL+DR + RCAAEDV TA+ EGA EL L L++ R A+ Sbjct 47 IPEDSVILSAQEAADLADRWFAARCAAEDVATAIAEGADTDELLALSTTLVKLTREAERL 106 Query 70 R 70 R Sbjct 107 R 107 >gi|296139907|ref|YP_003647150.1| hypothetical protein Tpau_2202 [Tsukamurella paurometabola DSM 20162] gi|296028041|gb|ADG78811.1| conserved hypothetical protein [Tsukamurella paurometabola DSM 20162] Length=111 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 32/62 (52%), Positives = 46/62 (75%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 +LP D+VVL+A +A +++R+++VRCAAEDV TA+ EGA EL +L D L+ ARAA+ Sbjct 50 SLPTDSVVLTAAEAEAVAERMFEVRCAAEDVQTAVAEGATIDELSELADRLVETARAAER 109 Query 69 WR 70 R Sbjct 110 LR 111 >gi|333919730|ref|YP_004493311.1| hypothetical protein AS9A_2062 [Amycolicicoccus subflavus DQS3-9A1] gi|333481951|gb|AEF40511.1| hypothetical protein AS9A_2062 [Amycolicicoccus subflavus DQS3-9A1] Length=55 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%) Query 16 VLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWR 70 +LSA +A+ L DR ++VRCAAEDV TA+ EGA ELR+L D L+ A+ A+ R Sbjct 1 MLSAAEASALVDRAFEVRCAAEDVATAIAEGAHGGELRELVDSLVNLAKEAERLR 55 >gi|38233812|ref|NP_939579.1| hypothetical protein DIP1224 [Corynebacterium diphtheriae NCTC 13129] gi|38200073|emb|CAE49750.1| Conserved hypothetical protein [Corynebacterium diphtheriae] Length=113 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/63 (42%), Positives = 41/63 (66%), Gaps = 0/63 (0%) Query 5 GEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAAR 64 G ALP AVVL + +L D +Y++RC+AED+ TA DEG + ++++LC EL+ A+ Sbjct 48 GAKTALPEGAVVLVPEKVDNLRDALYELRCSAEDIATAADEGISVEDMKELCAELVSLAK 107 Query 65 AAD 67 + Sbjct 108 KIE 110 >gi|255325676|ref|ZP_05366773.1| conserved hypothetical protein [Corynebacterium tuberculostearicum SK141] gi|311739415|ref|ZP_07713250.1| conserved hypothetical protein [Corynebacterium pseudogenitalium ATCC 33035] gi|255297286|gb|EET76606.1| conserved hypothetical protein [Corynebacterium tuberculostearicum SK141] gi|311305231|gb|EFQ81299.1| conserved hypothetical protein [Corynebacterium pseudogenitalium ATCC 33035] Length=56 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 25/56 (45%), Positives = 40/56 (72%), Gaps = 0/56 (0%) Query 15 VVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWR 70 ++L+ + A L D ++++RC+AED+ TA +EGA+A EL LC+EL+ AR +G R Sbjct 1 MILTPEKAESLRDGLFELRCSAEDINTAAEEGASAQELAGLCEELVALARRLEGLR 56 >gi|343927912|ref|ZP_08767378.1| hypothetical protein GOALK_099_00440 [Gordonia alkanivorans NBRC 16433] gi|343762135|dbj|GAA14304.1| hypothetical protein GOALK_099_00440 [Gordonia alkanivorans NBRC 16433] Length=93 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 30/62 (49%), Positives = 43/62 (70%), Gaps = 0/62 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADG 68 ++PADAV+LSA +AAD DR++ +RCAAED+ TA+ E A L +L D L+ A+ A+ Sbjct 32 SIPADAVILSAAEAADFGDRMFALRCAAEDLGTAVAERADHDVLTELTDTLLELAKEAEK 91 Query 69 WR 70 R Sbjct 92 LR 93 >gi|259507219|ref|ZP_05750119.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] gi|259165162|gb|EEW49716.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] Length=60 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 25/58 (44%), Positives = 40/58 (69%), Gaps = 0/58 (0%) Query 13 DAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWR 70 +AV+++ + A +L D ++++RCAAED+ TA+DEG A E+ LC EL+ AR + R Sbjct 2 NAVIMTPERADELRDSLFELRCAAEDIATAVDEGENAREVTALCTELVELARRIEKLR 59 >gi|340794372|ref|YP_004759835.1| hypothetical protein CVAR_1408 [Corynebacterium variabile DSM 44702] gi|340534282|gb|AEK36762.1| hypothetical protein CVAR_1408 [Corynebacterium variabile DSM 44702] Length=133 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 25/61 (41%), Positives = 41/61 (68%), Gaps = 0/61 (0%) Query 10 LPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGW 69 +PADA++L A DL+DR++++RC AED+ A++ G ++ +LC EL+ AR A+ Sbjct 58 VPADALILPRSAAEDLTDRLFELRCGAEDIAAAVEAGEDPGDISELCRELVALARTAEKI 117 Query 70 R 70 R Sbjct 118 R 118 >gi|296117869|ref|ZP_06836452.1| conserved hypothetical protein [Corynebacterium ammoniagenes DSM 20306] gi|295969100|gb|EFG82342.1| conserved hypothetical protein [Corynebacterium ammoniagenes DSM 20306] Length=68 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/57 (43%), Positives = 40/57 (71%), Gaps = 0/57 (0%) Query 14 AVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWR 70 A++LS + A +L D ++++RC+AED+ TA+ E A A+E+R L +EL+ AR + R Sbjct 12 ALILSPERAVNLHDGLFELRCSAEDIATAVQEEAPASEIRSLVEELVGIARRVEELR 68 >gi|145295611|ref|YP_001138432.1| hypothetical protein cgR_1538 [Corynebacterium glutamicum R] gi|140845531|dbj|BAF54530.1| hypothetical protein [Corynebacterium glutamicum R] gi|344045068|gb|EGV40742.1| hypothetical protein CgS9114_07080 [Corynebacterium glutamicum S9114] Length=54 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 0/54 (0%) Query 17 LSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWR 70 +S D A++L D ++++RCAAED+ TA++EG A ++ LC E++ AR + R Sbjct 1 MSPDRASELKDSLFELRCAAEDIATAVNEGEEARDIAKLCQEMVELARNIEKLR 54 >gi|334564301|ref|ZP_08517292.1| hypothetical protein CbovD2_06983 [Corynebacterium bovis DSM 20582] Length=107 Score = 50.4 bits (119), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/52 (49%), Positives = 36/52 (70%), Gaps = 0/52 (0%) Query 9 ALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELI 60 A+P+DA++L L D ++++RCAAEDV TA+ EG A L +LCDEL+ Sbjct 41 AVPSDALILPRSAVTALDDHLFELRCAAEDVRTAVTEGEEADGLLELCDELL 92 Lambda K H 0.319 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131500792262 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40