BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2128 Length=67 Score E Sequences producing significant alignments: (Bits) Value gi|15609265|ref|NP_216644.1| transmembrane protein [Mycobacteriu... 131 3e-29 gi|333988975|ref|YP_004521589.1| transmembrane protein [Mycobact... 80.9 6e-14 gi|118616243|ref|YP_904575.1| hypothetical protein MUL_0384 [Myc... 62.4 2e-08 gi|326334043|ref|ZP_08200272.1| hypothetical protein NBCG_05476 ... 49.7 1e-04 gi|183984784|ref|YP_001853075.1| hypothetical protein MMAR_4816 ... 43.5 0.009 gi|254502139|ref|ZP_05114290.1| putative transporter, CPA2 famil... 40.4 0.095 gi|118590724|ref|ZP_01548125.1| probable glutathione-regulated p... 39.7 0.15 gi|328545017|ref|YP_004305126.1| glutathione-regulated potassium... 38.1 0.39 gi|307941670|ref|ZP_07657025.1| glutathione-regulated potassium-... 37.7 0.53 gi|118471535|ref|YP_887036.1| hypothetical protein MSMEG_2701 [M... 35.8 1.9 gi|227821000|ref|YP_002824970.1| glutathione-regulated potassium... 34.7 5.3 gi|108757577|ref|YP_635069.1| glutathione-regulated potassium-ef... 33.5 9.6 >gi|15609265|ref|NP_216644.1| transmembrane protein [Mycobacterium tuberculosis H37Rv] gi|31793308|ref|NP_855801.1| transmembrane protein [Mycobacterium bovis AF2122/97] gi|121638010|ref|YP_978234.1| putative transmembrane protein [Mycobacterium bovis BCG str. Pasteur 1173P2] 72 more sequence titlesLength=67 Score = 131 bits (330), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 67/67 (100%), Positives = 67/67 (100%), Gaps = 0/67 (0%) Query 1 MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFA 60 MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFA Sbjct 1 MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFA 60 Query 61 LAFRDLS 67 LAFRDLS Sbjct 61 LAFRDLS 67 >gi|333988975|ref|YP_004521589.1| transmembrane protein [Mycobacterium sp. JDM601] gi|333484943|gb|AEF34335.1| transmembrane protein [Mycobacterium sp. JDM601] Length=60 Score = 80.9 bits (198), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 39/57 (69%), Positives = 45/57 (79%), Gaps = 0/57 (0%) Query 11 NRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS 67 NRYA+KPPLYGM +VF A+A+VAVTAY GWWS++GYA AAI V G LAFRD S Sbjct 4 NRYAAKPPLYGMVLVFCAIAIVAVTAYLHGGWWSVLGYAFAAITAVAGGVLAFRDFS 60 >gi|118616243|ref|YP_904575.1| hypothetical protein MUL_0384 [Mycobacterium ulcerans Agy99] gi|118568353|gb|ABL03104.1| conserved hypothetical transmembrane protein [Mycobacterium ulcerans Agy99] Length=80 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 31/56 (56%), Positives = 38/56 (68%), Gaps = 0/56 (0%) Query 12 RYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS 67 + +K PL GM+MVF AMA+VAVTAY GW+SIIGY AA + GF FRD+ Sbjct 5 DFKAKTPLIGMSMVFGAMALVAVTAYLHAGWYSIIGYVIAAAVAAFGFIFTFRDIP 60 >gi|326334043|ref|ZP_08200272.1| hypothetical protein NBCG_05476 [Nocardioidaceae bacterium Broad-1] gi|325948192|gb|EGD40303.1| hypothetical protein NBCG_05476 [Nocardioidaceae bacterium Broad-1] Length=74 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 33/61 (55%), Positives = 46/61 (76%), Gaps = 0/61 (0%) Query 7 SIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDL 66 ++ R+ Y + P+ GM MVFLA+A+V VTAY +GWWS+IGYAAAA+I V+G L F+D+ Sbjct 3 ALARDPYRPRTPIIGMVMVFLALAIVGVTAYLHLGWWSLIGYAAAAVIAVVGGWLLFKDV 62 Query 67 S 67 Sbjct 63 P 63 >gi|183984784|ref|YP_001853075.1| hypothetical protein MMAR_4816 [Mycobacterium marinum M] gi|183178110|gb|ACC43220.1| conserved hypothetical transmembrane protein [Mycobacterium marinum M] Length=80 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 32/55 (59%), Positives = 39/55 (71%), Gaps = 0/55 (0%) Query 13 YASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS 67 + +K PL GM+MVF AMA+VAVTAY GW+SIIGYA AA + GF FRD+ Sbjct 6 FKAKTPLIGMSMVFGAMALVAVTAYLHAGWYSIIGYAIAAAVAAFGFIFTFRDIP 60 >gi|254502139|ref|ZP_05114290.1| putative transporter, CPA2 family [Labrenzia alexandrii DFL-11] gi|222438210|gb|EEE44889.1| putative transporter, CPA2 family [Labrenzia alexandrii DFL-11] Length=596 Score = 40.4 bits (93), Expect = 0.095, Method: Compositional matrix adjust. Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%) Query 15 SKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGY-AAAAIIGVIGFAL 61 S PPL+ A++FL+ VVAV R+G S++GY AA A IG G L Sbjct 5 SAPPLFAEAIIFLSATVVAVPIAKRLGLGSVVGYLAAGAAIGPHGLQL 52 >gi|118590724|ref|ZP_01548125.1| probable glutathione-regulated potassium-efflux system transmembrane protein [Stappia aggregata IAM 12614] gi|118436700|gb|EAV43340.1| probable glutathione-regulated potassium-efflux system transmembrane protein [Stappia aggregata IAM 12614] Length=597 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 22/46 (48%), Positives = 29/46 (64%), Gaps = 1/46 (2%) Query 17 PPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGY-AAAAIIGVIGFAL 61 PP + ++VFLA VVAV R+G S++GY AA A+IG G L Sbjct 7 PPFFAESIVFLAATVVAVPIAKRLGLGSVVGYLAAGAVIGPHGLKL 52 >gi|328545017|ref|YP_004305126.1| glutathione-regulated potassium-efflux system transmembrane protein [Polymorphum gilvum SL003B-26A1] gi|326414759|gb|ADZ71822.1| Probable glutathione-regulated potassium-efflux system transmembrane protein [Polymorphum gilvum SL003B-26A1] Length=591 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%) Query 17 PPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAI 53 PPL+ A++FLA VVAV R+G S++GY AA + Sbjct 7 PPLFTEAIIFLAATVVAVPLAKRLGLGSVVGYLAAGV 43 >gi|307941670|ref|ZP_07657025.1| glutathione-regulated potassium-efflux system protein KefB [Roseibium sp. TrichSKD4] gi|307775278|gb|EFO34484.1| glutathione-regulated potassium-efflux system protein KefB [Roseibium sp. TrichSKD4] Length=570 Score = 37.7 bits (86), Expect = 0.53, Method: Compositional matrix adjust. Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 1/46 (2%) Query 15 SKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGY-AAAAIIGVIGF 59 + PP + ++VFLA VVAV R+G S++GY AA A IG G Sbjct 5 TAPPFFAESIVFLAATVVAVPIAKRLGLGSVVGYLAAGAAIGPFGL 50 >gi|118471535|ref|YP_887036.1| hypothetical protein MSMEG_2701 [Mycobacterium smegmatis str. MC2 155] gi|118172822|gb|ABK73718.1| hypothetical protein MSMEG_2701 [Mycobacterium smegmatis str. MC2 155] Length=67 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 0/53 (0%) Query 13 YASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRD 65 + + PLYG+ +V A+ + +TA GW ++GY A IGV GF + RD Sbjct 6 HPQRTPLYGVLLVVAAVLLCWLTASAFTGWQMVVGYLLAVAIGVFGFVMTLRD 58 >gi|227821000|ref|YP_002824970.1| glutathione-regulated potassium-efflux system protein [Sinorhizobium fredii NGR234] gi|227339999|gb|ACP24217.1| glutathione-regulated potassium-efflux system protein [Sinorhizobium fredii NGR234] Length=618 Score = 34.7 bits (78), Expect = 5.3, Method: Compositional matrix adjust. Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 0/40 (0%) Query 15 SKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAII 54 + P LY A++ L AVVA + R+G +I+GY AA I+ Sbjct 3 TTPILYTQALMLLGGAVVAAPLFKRLGLGTILGYLAAGIV 42 >gi|108757577|ref|YP_635069.1| glutathione-regulated potassium-efflux system [Myxococcus xanthus DK 1622] gi|108461457|gb|ABF86642.1| glutathione-regulated potassium-efflux system [Myxococcus xanthus DK 1622] Length=595 Score = 33.5 bits (75), Expect = 9.6, Method: Compositional matrix adjust. Identities = 21/41 (52%), Positives = 27/41 (66%), Gaps = 1/41 (2%) Query 22 MAMVFLAMAVVAVTAYFRMGWWSIIGY-AAAAIIGVIGFAL 61 A+VFLA AV+AV R+G S++GY AA A+IG G L Sbjct 6 QALVFLAAAVLAVPLSRRLGLGSVLGYLAAGAVIGPWGLKL 46 Lambda K H 0.334 0.141 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 129524807608 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40