BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2231A Length=141 Score E Sequences producing significant alignments: (Bits) Value gi|332321861|sp|P0CV93.1|VPC16_MYCTU RecName: Full=Probable ribo... 284 3e-75 gi|15841724|ref|NP_336761.1| hypothetical protein MT2291 [Mycoba... 281 3e-74 gi|254551274|ref|ZP_05141721.1| toxin [Mycobacterium tuberculosi... 277 3e-73 gi|336178545|ref|YP_004583920.1| PilT protein domain-containing ... 80.5 7e-14 gi|17230961|ref|NP_487509.1| hypothetical protein alr3469 [Nosto... 58.9 3e-07 gi|166365123|ref|YP_001657396.1| hypothetical protein MAE_23820 ... 54.7 5e-06 gi|295695543|ref|YP_003588781.1| PilT protein domain-containing ... 52.0 3e-05 gi|158336941|ref|YP_001518116.1| PilT domain-containing protein ... 50.8 7e-05 gi|218246270|ref|YP_002371641.1| PilT protein domain-containing ... 50.4 9e-05 gi|334120798|ref|ZP_08494876.1| PilT protein domain protein [Mic... 50.1 1e-04 gi|332710364|ref|ZP_08430312.1| hypothetical protein LYNGBM3L_50... 50.1 1e-04 gi|16332079|ref|NP_442807.1| hypothetical protein sll0525 [Synec... 50.1 1e-04 gi|289522649|ref|ZP_06439503.1| toxin-antitoxin system, toxin co... 49.3 2e-04 gi|322433349|ref|YP_004210566.1| PilT protein domain protein [Ac... 48.9 3e-04 gi|254416175|ref|ZP_05029930.1| hypothetical protein MC7420_7597... 48.1 4e-04 gi|37523124|ref|NP_926501.1| hypothetical protein gll3555 [Gloeo... 47.8 5e-04 gi|156743623|ref|YP_001433752.1| PilT domain-containing protein ... 47.4 7e-04 gi|258591552|emb|CBE67853.1| PilT-like protein [NC10 bacterium '... 47.0 8e-04 gi|333978034|ref|YP_004515979.1| PilT protein domain-containing ... 47.0 9e-04 gi|67924869|ref|ZP_00518264.1| PilT protein, N-terminal [Crocosp... 47.0 0.001 gi|333991529|ref|YP_004524143.1| hypothetical protein JDM601_288... 46.6 0.001 gi|254416012|ref|ZP_05029768.1| hypothetical protein MC7420_8287... 46.2 0.002 gi|67926060|ref|ZP_00519314.1| PilT protein, N-terminal [Crocosp... 45.8 0.002 gi|166363231|ref|YP_001655504.1| hypothetical protein MAE_04900 ... 45.8 0.002 gi|153876926|ref|ZP_02003999.1| PilT-like protein [Beggiatoa sp.... 45.4 0.003 gi|254470330|ref|ZP_05083734.1| PilT protein domain protein [Pse... 45.1 0.004 gi|75910247|ref|YP_324543.1| PilT protein-like protein [Anabaena... 44.7 0.005 gi|172038029|ref|YP_001804530.1| putative PilT like protein [Cya... 44.7 0.005 gi|325066696|ref|ZP_08125369.1| hypothetical protein AoriK_02699... 44.7 0.005 gi|186680901|ref|YP_001864097.1| PilT domain-containing protein ... 44.3 0.006 gi|326772611|ref|ZP_08231895.1| toxin-antitoxin system, toxin co... 43.9 0.007 gi|299136180|ref|ZP_07029364.1| PilT protein domain protein [Aci... 43.9 0.008 gi|220909368|ref|YP_002484679.1| PilT protein domain-containing ... 43.9 0.008 gi|209550314|ref|YP_002282231.1| PilT protein domain-containing ... 43.5 0.011 gi|333966151|gb|AEG32916.1| PilT protein domain protein [Thermus... 43.5 0.011 gi|55980456|ref|YP_143753.1| hypothetical protein TTHA0487 [Ther... 43.5 0.011 gi|46198421|ref|YP_004088.1| hypothetical protein TTC0113 [Therm... 43.5 0.012 gi|318042885|ref|ZP_07974841.1| PilT domain-containing protein [... 43.1 0.012 gi|288947768|ref|YP_003445151.1| PilT protein domain protein [Al... 43.1 0.013 gi|206602006|gb|EDZ38488.1| Conserved hypothetical protein [Lept... 42.7 0.016 gi|289207391|ref|YP_003459457.1| PilT protein domain protein [Th... 42.7 0.017 gi|67920280|ref|ZP_00513800.1| PilT protein, N-terminal [Crocosp... 42.7 0.017 gi|170700479|ref|ZP_02891484.1| PilT protein domain protein [Bur... 42.7 0.018 gi|163848017|ref|YP_001636061.1| PilT domain-containing protein ... 42.7 0.018 gi|170732059|ref|YP_001764006.1| PilT domain-containing protein ... 42.0 0.029 gi|115350682|ref|YP_772521.1| PilT domain-containing protein [Bu... 42.0 0.030 gi|301059732|ref|ZP_07200628.1| toxin-antitoxin system, toxin co... 42.0 0.032 gi|218659722|ref|ZP_03515652.1| PilT protein domain protein [Rhi... 41.6 0.038 gi|218679216|ref|ZP_03527113.1| PilT protein domain protein [Rhi... 41.2 0.049 gi|88813610|ref|ZP_01128841.1| hypothetical protein NB231_12881 ... 41.2 0.055 >gi|332321861|sp|P0CV93.1|VPC16_MYCTU RecName: Full=Probable ribonuclease VapC16; Short=Probable RNase VapC16; AltName: Full=Toxin VapC16 Length=141 Score = 284 bits (726), Expect = 3e-75, Method: Compositional matrix adjust. Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%) Query 1 LTMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAA 60 +TMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAA Sbjct 1 MTMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAA 60 Query 61 SAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCA 120 SAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCA Sbjct 61 SAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCA 120 Query 121 HRPGTAAWPDDHHRRRPVSCL 141 HRPGTAAWPDDHHRRRPVSCL Sbjct 121 HRPGTAAWPDDHHRRRPVSCL 141 >gi|15841724|ref|NP_336761.1| hypothetical protein MT2291 [Mycobacterium tuberculosis CDC1551] gi|148823440|ref|YP_001288194.1| hypothetical protein TBFG_12261 [Mycobacterium tuberculosis F11] gi|167969368|ref|ZP_02551645.1| hypothetical protein MtubH3_15610 [Mycobacterium tuberculosis H37Ra] 35 more sequence titles Length=139 Score = 281 bits (718), Expect = 3e-74, Method: Compositional matrix adjust. Identities = 139/139 (100%), Positives = 139/139 (100%), Gaps = 0/139 (0%) Query 3 MACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASA 62 MACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASA Sbjct 1 MACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASA 60 Query 63 WEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHR 122 WEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHR Sbjct 61 WEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHR 120 Query 123 PGTAAWPDDHHRRRPVSCL 141 PGTAAWPDDHHRRRPVSCL Sbjct 121 PGTAAWPDDHHRRRPVSCL 139 >gi|254551274|ref|ZP_05141721.1| toxin [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] Length=139 Score = 277 bits (709), Expect = 3e-73, Method: Compositional matrix adjust. Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%) Query 3 MACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASA 62 MACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNET AIVQDVRNSILLSAASA Sbjct 1 MACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETWAIVQDVRNSILLSAASA 60 Query 63 WEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHR 122 WEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHR Sbjct 61 WEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHR 120 Query 123 PGTAAWPDDHHRRRPVSCL 141 PGTAAWPDDHHRRRPVSCL Sbjct 121 PGTAAWPDDHHRRRPVSCL 139 >gi|336178545|ref|YP_004583920.1| PilT protein domain-containing protein [Frankia symbiont of Datisca glomerata] gi|334859525|gb|AEH09999.1| PilT protein domain protein [Frankia symbiont of Datisca glomerata] Length=130 Score = 80.5 bits (197), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 37/61 (61%), Positives = 44/61 (73%), Gaps = 0/61 (0%) Query 43 ETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 +TR ++ D N ILLSAAS WEI+I YRLGKL PEP YVPDR+RR G PL+V+H H Sbjct 24 DTRDLLADTANEILLSAASGWEISIKYRLGKLALPEPPRGYVPDRIRRTGVIPLAVEHDH 83 Query 103 T 103 Sbjct 84 V 84 >gi|17230961|ref|NP_487509.1| hypothetical protein alr3469 [Nostoc sp. PCC 7120] gi|17132602|dbj|BAB75168.1| alr3469 [Nostoc sp. PCC 7120] Length=128 Score = 58.9 bits (141), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 28/59 (48%), Positives = 39/59 (67%), Gaps = 2/59 (3%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRM--RRCGTSPLSVDHA 101 R I+ D N++ SAASAWEI I RLGKL PEP +Y+P+R+ R + P+ ++HA Sbjct 25 RNIIADPGNNLFFSAASAWEIVIKVRLGKLNLPEPPETYIPNRLTINRFESLPIQMNHA 83 >gi|166365123|ref|YP_001657396.1| hypothetical protein MAE_23820 [Microcystis aeruginosa NIES-843] gi|166087496|dbj|BAG02204.1| hypothetical protein MAE_23820 [Microcystis aeruginosa NIES-843] Length=128 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 4/72 (5%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGT 93 P+L+ D + ++D +NS+ LS AS WE I Y+LGKLP PE Y+P + R Sbjct 18 PQLSQDFCDA----IKDAKNSVYLSVASIWEAIIKYQLGKLPLPESPEVYLPKQRDRHQI 73 Query 94 SPLSVDHAHTAH 105 + L++D A+ Sbjct 74 ASLTIDEESIAY 85 >gi|295695543|ref|YP_003588781.1| PilT protein domain-containing protein [Bacillus tusciae DSM 2912] gi|295411145|gb|ADG05637.1| PilT protein domain protein [Bacillus tusciae DSM 2912] Length=128 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 RAI+QD RN + LSAASAWEIAI LG++ E ++ +M G L V+ H Sbjct 25 RAIIQDTRNELYLSAASAWEIAIKAALGRIRVYEDLDRFMTQQMNENGIVDLPVEILH 82 >gi|158336941|ref|YP_001518116.1| PilT domain-containing protein [Acaryochloris marina MBIC11017] gi|158307182|gb|ABW28799.1| PIN domain protein [Acaryochloris marina MBIC11017] Length=128 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 0/59 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHT 103 R +++ + +LLS S WEI I Y+LGKLP PE Y+P R+ L V H Sbjct 25 RQFIENSDHILLLSVVSVWEIVIKYKLGKLPLPESPEIYIPKRLEYYQFQILPVHLPHV 83 >gi|218246270|ref|YP_002371641.1| PilT protein domain-containing protein [Cyanothece sp. PCC 8801] gi|218166748|gb|ACK65485.1| PilT protein domain protein [Cyanothece sp. PCC 8801] Length=132 Score = 50.4 bits (119), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 0/50 (0%) Query 53 NSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 N + S AS WE+ I +GKLP PEP YV RM + G L ++ +H Sbjct 33 NEVWFSVASVWEMGIKVSIGKLPLPEPIDDYVSTRMTQLGARSLKINASH 82 >gi|334120798|ref|ZP_08494876.1| PilT protein domain protein [Microcoleus vaginatus FGP-2] gi|333456070|gb|EGK84708.1| PilT protein domain protein [Microcoleus vaginatus FGP-2] Length=133 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 30/76 (40%), Positives = 39/76 (52%), Gaps = 5/76 (6%) Query 39 DAVNETRAIVQ--DVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPL 96 D +NE AI Q D N + S AS WE+ I +GKLP PEP +Y+ RM + G L Sbjct 18 DRLNE-EAIAQIADETNELWFSVASVWEMGIKVAIGKLPLPEPIDTYISTRMIQLGARSL 76 Query 97 SVDHAHTAHRRASGSP 112 + H RA+ P Sbjct 77 EITAPHAL--RAAALP 90 >gi|332710364|ref|ZP_08430312.1| hypothetical protein LYNGBM3L_50600 [Lyngbya majuscula 3L] gi|332350913|gb|EGJ30505.1| hypothetical protein LYNGBM3L_50600 [Lyngbya majuscula 3L] Length=134 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/63 (34%), Positives = 32/63 (51%), Gaps = 0/63 (0%) Query 43 ETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 + R I++D N + LS S WE + Y+LGKLP PEP ++P + + L +D Sbjct 23 DVRDIIRDPDNEVYLSVVSVWEAIVKYQLGKLPLPEPPEKFLPKQRELHQIASLDLDEGS 82 Query 103 TAH 105 Sbjct 83 VTQ 85 >gi|16332079|ref|NP_442807.1| hypothetical protein sll0525 [Synechocystis sp. PCC 6803] gi|1001388|dbj|BAA10878.1| sll0525 [Synechocystis sp. PCC 6803] gi|339275176|dbj|BAK51663.1| hypothetical protein SYNGTS_2915 [Synechocystis sp. PCC 6803] Length=131 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/68 (37%), Positives = 36/68 (53%), Gaps = 4/68 (5%) Query 35 RLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTS 94 +L DA+++ + D N I LS AS WE++I +GKLP PE Y+ RM + G Sbjct 19 KLNEDAISQ----IIDETNEIWLSVASIWEMSIKTSIGKLPLPENIDDYILSRMVKLGAE 74 Query 95 PLSVDHAH 102 L + H Sbjct 75 FLDIKTRH 82 >gi|289522649|ref|ZP_06439503.1| toxin-antitoxin system, toxin component, PIN family [Anaerobaculum hydrogeniformans ATCC BAA-1850] gi|289504485|gb|EFD25649.1| toxin-antitoxin system, toxin component, PIN family [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length=128 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 26/72 (37%), Positives = 39/72 (55%), Gaps = 4/72 (5%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGT 93 PRL+ A R I+ D +N + LSAAS WEIAI +LGKL + ++P+++ Sbjct 18 PRLSEKA----REIMGDGKNQLFLSAASGWEIAIKAKLGKLKVSDNLEHFIPEQVALNAI 73 Query 94 SPLSVDHAHTAH 105 L + +H H Sbjct 74 ENLPIVLSHVLH 85 >gi|322433349|ref|YP_004210566.1| PilT protein domain protein [Acidobacterium sp. MP5ACTX9] gi|321165738|gb|ADW71439.1| PilT protein domain protein [Acidobacterium sp. MP5ACTX9] Length=128 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 24/52 (47%), Positives = 31/52 (60%), Gaps = 0/52 (0%) Query 48 VQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVD 99 + D RN+IL+S ASAWEIA R+GKLP E D + G + LS+D Sbjct 28 IADERNTILVSTASAWEIATKVRVGKLPGAEAFERDFLDIIEIAGYNLLSID 79 >gi|254416175|ref|ZP_05029930.1| hypothetical protein MC7420_7597 [Microcoleus chthonoplastes PCC 7420] gi|196177108|gb|EDX72117.1| hypothetical protein MC7420_7597 [Microcoleus chthonoplastes PCC 7420] Length=132 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 21/55 (39%), Positives = 28/55 (51%), Gaps = 0/55 (0%) Query 48 VQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 + D N + S AS WE+ I +GKLP PE YV RM + G L + +H Sbjct 28 IADETNEVWFSVASVWEMGIKVSIGKLPLPEQIDDYVSTRMTQLGARSLEITASH 82 >gi|37523124|ref|NP_926501.1| hypothetical protein gll3555 [Gloeobacter violaceus PCC 7421] gi|35214127|dbj|BAC91496.1| gll3555 [Gloeobacter violaceus PCC 7421] Length=128 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 6/77 (7%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGT 93 P+L+ A R V D +N LLS AS WE+AI LGKL P +++P+++ G Sbjct 18 PQLSVSA----RTAVADPQNVCLLSLASCWEMAIKASLGKLKLPSALENFIPEQLLINGF 73 Query 94 SPLSVDHAHTAHRRASG 110 L +D H R SG Sbjct 74 QTLDIDFRHIV--RVSG 88 >gi|156743623|ref|YP_001433752.1| PilT domain-containing protein [Roseiflexus castenholzii DSM 13941] gi|156234951|gb|ABU59734.1| PilT protein domain protein [Roseiflexus castenholzii DSM 13941] Length=128 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 35/60 (59%), Gaps = 0/60 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTA 104 RA+++D+ N LS AS WE+AI LG+L +P +++P ++ L + +HTA Sbjct 25 RALIEDMSNDAYLSIASLWEMAIKISLGRLQLAQPFETFIPHQLSLNRIGLLGITISHTA 84 >gi|258591552|emb|CBE67853.1| PilT-like protein [NC10 bacterium 'Dutch sediment'] Length=128 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 21/46 (46%), Positives = 27/46 (59%), Gaps = 0/46 (0%) Query 39 DAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYV 84 D + R D N + LSA SAWEI I +RLG+LP PEP ++ Sbjct 19 DLSSSARQFFSDPDNEVYLSAVSAWEIVIKHRLGRLPLPEPPRQFI 64 >gi|333978034|ref|YP_004515979.1| PilT protein domain-containing protein [Desulfotomaculum kuznetsovii DSM 6115] gi|333821515|gb|AEG14178.1| PilT protein domain protein [Desulfotomaculum kuznetsovii DSM 6115] Length=128 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 23/61 (38%), Positives = 33/61 (55%), Gaps = 0/61 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTA 104 R I+ N + LSAAS WE+AI RLGKL P+ ++ +++ PL+V H Sbjct 25 RKIISSGENKLYLSAASGWEMAIKARLGKLSLPDNPEPFILEQLAVNAIEPLAVSMRHAL 84 Query 105 H 105 H Sbjct 85 H 85 >gi|67924869|ref|ZP_00518264.1| PilT protein, N-terminal [Crocosphaera watsonii WH 8501] gi|67853298|gb|EAM48662.1| PilT protein, N-terminal [Crocosphaera watsonii WH 8501] Length=128 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/68 (33%), Positives = 36/68 (53%), Gaps = 4/68 (5%) Query 35 RLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTS 94 +L+ A++E + N +LLS AS WEI I Y++ KL P+ +P +M+ Sbjct 19 KLSQTALDE----IMGFNNELLLSVASIWEIGIKYKINKLKLPQTPEILIPQQMQMDDIE 74 Query 95 PLSVDHAH 102 LS+ +H Sbjct 75 TLSIKVSH 82 >gi|333991529|ref|YP_004524143.1| hypothetical protein JDM601_2889 [Mycobacterium sp. JDM601] gi|333487497|gb|AEF36889.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=134 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 23/58 (40%), Positives = 32/58 (56%), Gaps = 0/58 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 RA+++D + +L SAASAWE+A RLGKLP + + R G L +D H Sbjct 30 RAVIEDRSDRLLTSAASAWELATKSRLGKLPQADALLGAYTRYLDRLGVVRLPIDDEH 87 >gi|254416012|ref|ZP_05029768.1| hypothetical protein MC7420_8287 [Microcoleus chthonoplastes PCC 7420] gi|196177187|gb|EDX72195.1| hypothetical protein MC7420_8287 [Microcoleus chthonoplastes PCC 7420] Length=129 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 23/57 (41%), Positives = 30/57 (53%), Gaps = 0/57 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHA 101 R +Q+ N + LS S WE I Y+LGKL PE Y+P + R L+VD A Sbjct 25 RDTIQNPDNDVYLSVVSLWECIIKYQLGKLLLPESPEIYLPKQRERHQIDSLAVDEA 81 >gi|67926060|ref|ZP_00519314.1| PilT protein, N-terminal [Crocosphaera watsonii WH 8501] gi|67852095|gb|EAM47600.1| PilT protein, N-terminal [Crocosphaera watsonii WH 8501] Length=127 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 26/66 (40%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Query 35 RLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTS 94 RL+ D N R D N + LS S WE + Y+LGKLP PEP Y+P + Sbjct 19 RLSIDICNCIR----DSGNEVYLSVVSIWECIVKYQLGKLPLPEPPEIYLPRQRNLHEII 74 Query 95 PLSVDH 100 L+VD Sbjct 75 NLNVDE 80 >gi|166363231|ref|YP_001655504.1| hypothetical protein MAE_04900 [Microcystis aeruginosa NIES-843] gi|166085604|dbj|BAG00312.1| hypothetical protein MAE_04900 [Microcystis aeruginosa NIES-843] Length=109 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/60 (32%), Positives = 31/60 (52%), Gaps = 0/60 (0%) Query 48 VQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRR 107 +++ N + LS S WE I Y+LGKL PE Y+P + ++ + L +D H + Sbjct 9 IKNSNNEVFLSVVSVWECVIKYQLGKLNFPERPDLYLPKKRKQHLINSLVIDEKSLVHLK 68 >gi|153876926|ref|ZP_02003999.1| PilT-like protein [Beggiatoa sp. PS] gi|152066611|gb|EDN66002.1| PilT-like protein [Beggiatoa sp. PS] Length=129 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 27/70 (39%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGT 93 P L+ +A R DV N I LSA SAWEIA+ LGKLP P +V ++ Sbjct 19 PELSENA----RTTFYDVENQIYLSAVSAWEIAVKNALGKLPLPNTPDIFVQEQRELHQI 74 Query 94 SPLSVDHAHT 103 L +D + T Sbjct 75 ESLPLDESST 84 >gi|254470330|ref|ZP_05083734.1| PilT protein domain protein [Pseudovibrio sp. JE062] gi|211960641|gb|EEA95837.1| PilT protein domain protein [Pseudovibrio sp. JE062] Length=128 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%) Query 43 ETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 + +AI+ D N + +SAAS+WEIAI LGKL P+ AS + + + P+S+ H Sbjct 24 KAQAIIADPHNEVFVSAASSWEIAIKQNLGKLTAPKGLASIIDE--EGFLSLPISLFHGE 81 Query 103 TA 104 A Sbjct 82 QA 83 >gi|75910247|ref|YP_324543.1| PilT protein-like protein [Anabaena variabilis ATCC 29413] gi|75703972|gb|ABA23648.1| PilT protein-like protein [Anabaena variabilis ATCC 29413] Length=127 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 20/58 (35%), Positives = 33/58 (57%), Gaps = 0/58 (0%) Query 43 ETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDH 100 + R ++D N + LS+ S WE + Y+LGKLP PE +Y+P + + L++D Sbjct 23 DVRDAIRDPDNDVYLSSVSIWEAIVKYQLGKLPLPEQPETYLPKQRDLHQIASLALDE 80 >gi|172038029|ref|YP_001804530.1| putative PilT like protein [Cyanothece sp. ATCC 51142] gi|171699483|gb|ACB52464.1| putative PilT like protein [Cyanothece sp. ATCC 51142] Length=78 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 23/56 (42%), Positives = 29/56 (52%), Gaps = 4/56 (7%) Query 35 RLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRR 90 RL+ D N R D N + LS S WE + Y+LGKLP PE Y+P + R Sbjct 19 RLSIDICNYIR----DSDNEVYLSVVSIWECIVKYQLGKLPLPESPEIYLPKQRNR 70 >gi|325066696|ref|ZP_08125369.1| hypothetical protein AoriK_02699 [Actinomyces oris K20] Length=130 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 29/83 (35%), Positives = 42/83 (51%), Gaps = 7/83 (8%) Query 35 RLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTS 94 RL AV +++D N +++SAASAWE+ R+GKLP P + +RR G Sbjct 20 RLGGKAVE----VLRDRGNLLVVSAASAWELHTKNRIGKLPGAGPWLDALEGHVRRLGAE 75 Query 95 PLSVDHAHTAHRRASGSPSTSIR 117 L ++ +H R SG S R Sbjct 76 FLPIEWSHA---RLSGQLEWSHR 95 >gi|186680901|ref|YP_001864097.1| PilT domain-containing protein [Nostoc punctiforme PCC 73102] gi|186463353|gb|ACC79154.1| PilT protein domain protein [Nostoc punctiforme PCC 73102] Length=132 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 20/55 (37%), Positives = 28/55 (51%), Gaps = 0/55 (0%) Query 48 VQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 + D N + LS AS WE+ I +GKLP +P SY+ RM L + +H Sbjct 28 IADETNELWLSVASIWEMGIKVAIGKLPLADPLDSYISSRMTVLAMRSLEITASH 82 >gi|326772611|ref|ZP_08231895.1| toxin-antitoxin system, toxin component, PIN family [Actinomyces viscosus C505] gi|343523066|ref|ZP_08760031.1| PIN domain protein [Actinomyces sp. oral taxon 175 str. F0384] gi|326637243|gb|EGE38145.1| toxin-antitoxin system, toxin component, PIN family [Actinomyces viscosus C505] gi|343400814|gb|EGV13326.1| PIN domain protein [Actinomyces sp. oral taxon 175 str. F0384] Length=130 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 29/83 (35%), Positives = 42/83 (51%), Gaps = 7/83 (8%) Query 35 RLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTS 94 RL AV +++D N +++SAASAWE+ R+GKLP P + +RR G Sbjct 20 RLGGRAVE----VLRDRGNLVVVSAASAWELHTKNRIGKLPGAGPWLDALEGHVRRLGAE 75 Query 95 PLSVDHAHTAHRRASGSPSTSIR 117 L ++ +H R SG S R Sbjct 76 FLPIEWSHA---RLSGQLEWSHR 95 >gi|299136180|ref|ZP_07029364.1| PilT protein domain protein [Acidobacterium sp. MP5ACTX8] gi|298602304|gb|EFI58458.1| PilT protein domain protein [Acidobacterium sp. MP5ACTX8] Length=128 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%) Query 47 IVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTS--PLSVDHAHTA 104 ++ + N+I +SAASAWEIA R+GKLP E M G + P+++D A A Sbjct 27 VIGNEANTIFVSAASAWEIATKVRIGKLPQAEALEKDFSAAMSGAGYTLLPITIDDALRA 86 Query 105 HR 106 R Sbjct 87 GR 88 >gi|220909368|ref|YP_002484679.1| PilT protein domain-containing protein [Cyanothece sp. PCC 7425] gi|219865979|gb|ACL46318.1| PilT protein domain protein [Cyanothece sp. PCC 7425] Length=127 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 19/48 (40%), Positives = 28/48 (59%), Gaps = 0/48 (0%) Query 53 NSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDH 100 N + LSA S WE + Y+LGKLP PE +Y+P + + L++D Sbjct 33 NEVYLSAVSVWEAMVKYQLGKLPLPESPETYLPKQRDLHQIASLALDE 80 >gi|209550314|ref|YP_002282231.1| PilT protein domain-containing protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209536070|gb|ACI56005.1| PilT protein domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length=128 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 22/49 (45%), Positives = 28/49 (58%), Gaps = 1/49 (2%) Query 56 LLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTA 104 +S AS WE+AI RLGKL P P + +P +R G + LSVD H Sbjct 37 FVSVASLWEVAIKTRLGKLQPGLPLET-IPIYLREVGLTILSVDVPHVV 84 >gi|333966151|gb|AEG32916.1| PilT protein domain protein [Thermus thermophilus SG0.5JP17-16] Length=130 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 22/59 (38%), Positives = 33/59 (56%), Gaps = 0/59 (0%) Query 44 TRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 RA+++D +L+S+ASAWE+A +RLGKL E + + R G L + AH Sbjct 26 VRALLEDPDTPLLVSSASAWEMATKHRLGKLSGAEAVLEGLEGHLSRLGAEELPIRLAH 84 >gi|55980456|ref|YP_143753.1| hypothetical protein TTHA0487 [Thermus thermophilus HB8] gi|55771869|dbj|BAD70310.1| conserved hypothetical protein [Thermus thermophilus HB8] Length=130 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 22/59 (38%), Positives = 33/59 (56%), Gaps = 0/59 (0%) Query 44 TRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 RA+++D +L+S+ASAWE+A +RLGKL E + + R G L + AH Sbjct 26 VRALLEDPDTPLLVSSASAWEMATKHRLGKLSGAEAVLEGLEGHLSRLGAEELPIRLAH 84 >gi|46198421|ref|YP_004088.1| hypothetical protein TTC0113 [Thermus thermophilus HB27] gi|46196043|gb|AAS80461.1| hypothetical conserved protein [Thermus thermophilus HB27] Length=130 Score = 43.5 bits (101), Expect = 0.012, Method: Compositional matrix adjust. Identities = 22/59 (38%), Positives = 33/59 (56%), Gaps = 0/59 (0%) Query 44 TRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAH 102 RA+++D +L+S+ASAWE+A +RLGKL E + + R G L + AH Sbjct 26 VRALLEDPDTPLLVSSASAWEMATKHRLGKLSGAEAVLEGLEGHLSRLGAEELPIRLAH 84 >gi|318042885|ref|ZP_07974841.1| PilT domain-containing protein [Synechococcus sp. CB0101] Length=94 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 32/58 (56%), Gaps = 2/58 (3%) Query 55 ILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSP 112 + +SAA+AWE+A RLGKL EP S +P + G LSVD H RA G P Sbjct 1 MFVSAATAWELATKVRLGKLEIAEPLLSDLPCLLAAQGFELLSVDLRHGL--RAGGYP 56 >gi|288947768|ref|YP_003445151.1| PilT protein domain protein [Allochromatium vinosum DSM 180] gi|288898284|gb|ADC64119.1| PilT protein domain protein [Allochromatium vinosum DSM 180] Length=128 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 23/69 (34%), Positives = 38/69 (56%), Gaps = 4/69 (5%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGT 93 PRL+ + R + D N + +SAASAWE+A +RLGKL E + + + G Sbjct 18 PRLS----DRAREAISDDGNPVFVSAASAWEMATKHRLGKLGEAEGAIERFAELVAADGF 73 Query 94 SPLSVDHAH 102 + L++++ H Sbjct 74 THLAINYFH 82 >gi|206602006|gb|EDZ38488.1| Conserved hypothetical protein [Leptospirillum sp. Group II '5-way CG'] Length=128 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 20/61 (33%), Positives = 31/61 (51%), Gaps = 0/61 (0%) Query 44 TRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHT 103 R ++ D + +S AS WE+AI LGKL P +VP+++ LS+D H Sbjct 24 VRELLSDPQTEGFISLASVWEMAIKVSLGKLRVSAPLEKFVPEQLSLNNFQILSIDFRHI 83 Query 104 A 104 + Sbjct 84 S 84 >gi|289207391|ref|YP_003459457.1| PilT protein domain protein [Thioalkalivibrio sp. K90mix] gi|288943022|gb|ADC70721.1| PilT protein domain protein [Thioalkalivibrio sp. K90mix] Length=128 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 21/61 (35%), Positives = 35/61 (58%), Gaps = 0/61 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTA 104 R ++ D+ +++L+SAASAWEIA +RLGKL + + G + L+V++ Sbjct 25 REVIGDLESTVLVSAASAWEIATKHRLGKLQIGGVVIQRFDELVTADGFTHLAVNYPQAI 84 Query 105 H 105 H Sbjct 85 H 85 >gi|67920280|ref|ZP_00513800.1| PilT protein, N-terminal [Crocosphaera watsonii WH 8501] gi|67857764|gb|EAM53003.1| PilT protein, N-terminal [Crocosphaera watsonii WH 8501] Length=129 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 24/72 (34%), Positives = 34/72 (48%), Gaps = 4/72 (5%) Query 33 HPRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCG 92 HP L+ N R I+ DV + L+S AS WE+ I GKL P Y+ D+++ Sbjct 17 HPNLS----NRGRQIMDDVNHQKLISLASVWEMGIKQSKGKLSLSLPLEDYINDKIKLED 72 Query 93 TSPLSVDHAHTA 104 L + H A Sbjct 73 FDLLPIKLNHLA 84 >gi|170700479|ref|ZP_02891484.1| PilT protein domain protein [Burkholderia ambifaria IOP40-10] gi|170134603|gb|EDT02926.1| PilT protein domain protein [Burkholderia ambifaria IOP40-10] Length=129 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 24/58 (42%), Positives = 35/58 (61%), Gaps = 5/58 (8%) Query 46 AIVQDVRNSILLSAASAWEIAINYRLGKLP--PPEPSASYVPDRMRRCGTSPLSVDHA 101 A++ D N++ +SAAS WEIAI YR G LP P + +++ R+ P+S DHA Sbjct 26 ALIDDPLNTLYVSAASIWEIAIKYRKGNLPVHPRDARSAF---RLAGFAELPISSDHA 80 >gi|163848017|ref|YP_001636061.1| PilT domain-containing protein [Chloroflexus aurantiacus J-10-fl] gi|222525902|ref|YP_002570373.1| PilT protein domain-containing protein [Chloroflexus sp. Y-400-fl] gi|163669306|gb|ABY35672.1| PilT protein domain protein [Chloroflexus aurantiacus J-10-fl] gi|222449781|gb|ACM54047.1| PilT protein domain protein [Chloroflexus sp. Y-400-fl] Length=103 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 18/59 (31%), Positives = 33/59 (56%), Gaps = 0/59 (0%) Query 45 RAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHT 103 R ++++ + +LLS AS WE+AI LG+L +P ++P ++ + L + HT Sbjct 25 RTLIEEPTSEVLLSVASVWEMAIKVSLGRLQLSQPFELFIPHQLLLNDITLLDITLNHT 83 >gi|170732059|ref|YP_001764006.1| PilT domain-containing protein [Burkholderia cenocepacia MC0-3] gi|254246266|ref|ZP_04939587.1| hypothetical protein BCPG_01000 [Burkholderia cenocepacia PC184] gi|124871042|gb|EAY62758.1| hypothetical protein BCPG_01000 [Burkholderia cenocepacia PC184] gi|169815301|gb|ACA89884.1| PilT protein domain protein [Burkholderia cenocepacia MC0-3] Length=129 Score = 42.0 bits (97), Expect = 0.029, Method: Compositional matrix adjust. Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 9/70 (12%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLP--PPEPSASYVPDRMRRC 91 P+L+A A A+++ +N++ +SAAS WEIAI YR G LP P + +++ R+ Sbjct 18 PQLSATAA----ALIEHPQNTLYVSAASIWEIAIKYRKGNLPVHPRDARSAF---RLAGF 70 Query 92 GTSPLSVDHA 101 P+S DHA Sbjct 71 AELPISSDHA 80 >gi|115350682|ref|YP_772521.1| PilT domain-containing protein [Burkholderia ambifaria AMMD] gi|115280670|gb|ABI86187.1| PilT protein domain protein [Burkholderia ambifaria AMMD] Length=129 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 9/70 (12%) Query 34 PRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLP--PPEPSASYVPDRMRRC 91 P+L+A A A+++ +N++ +SAAS WEIAI YR G LP P + +++ R+ Sbjct 18 PQLSATAA----ALIEHPQNTLYVSAASIWEIAIKYRKGNLPVHPRDARSAF---RLAGF 70 Query 92 GTSPLSVDHA 101 P+S DHA Sbjct 71 AELPISSDHA 80 >gi|301059732|ref|ZP_07200628.1| toxin-antitoxin system, toxin component, PIN family [delta proteobacterium NaphS2] gi|300446152|gb|EFK10021.1| toxin-antitoxin system, toxin component, PIN family [delta proteobacterium NaphS2] Length=129 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 22/59 (38%), Positives = 34/59 (58%), Gaps = 2/59 (3%) Query 48 VQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCG--TSPLSVDHAHTA 104 +++ N I +SAAS WEI+ +RLG+L A VP+ + R G + P++ HA A Sbjct 26 LKNKDNEIYVSAASVWEISTKFRLGRLSEASEVAKDVPEWIIRAGFQSMPVTARHAQLA 84 >gi|218659722|ref|ZP_03515652.1| PilT protein domain protein [Rhizobium etli IE4771] Length=130 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 28/81 (35%), Positives = 37/81 (46%), Gaps = 9/81 (11%) Query 23 AFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSAS 82 A + L R PR ++ D S +S AS WEIAI RLGKL P P + Sbjct 14 AIAQKQLTERFPR--------VEQLLSDHAASGFVSVASLWEIAIKTRLGKLQPGLPLET 65 Query 83 YVPDRMRRCGTSPLSVDHAHT 103 +P +R G + L +D H Sbjct 66 -IPIYLRETGLTILPIDVPHV 85 >gi|218679216|ref|ZP_03527113.1| PilT protein domain protein [Rhizobium etli CIAT 894] Length=106 Score = 41.2 bits (95), Expect = 0.049, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 31/60 (52%), Gaps = 1/60 (1%) Query 44 TRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHT 103 ++ D S +S AS WEIAI RLGKL P P + +P +R G + L VD H Sbjct 3 VEQLLSDGAASGFVSVASLWEIAIKTRLGKLQPGLPLET-IPVYLREAGLTILPVDIPHV 61 >gi|88813610|ref|ZP_01128841.1| hypothetical protein NB231_12881 [Nitrococcus mobilis Nb-231] gi|88789115|gb|EAR20251.1| hypothetical protein NB231_12881 [Nitrococcus mobilis Nb-231] Length=128 Score = 41.2 bits (95), Expect = 0.055, Method: Compositional matrix adjust. Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%) Query 46 AIVQDVRNSILLSAASAWEIAINYRLGKLP 75 A+++D + +SAASAWEI+ YRLGKLP Sbjct 26 ALLEDDDTGVFVSAASAWEISTKYRLGKLP 55 Lambda K H 0.321 0.130 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 130347035928 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40