BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2255c Length=64 Score E Sequences producing significant alignments: (Bits) Value gi|15609392|ref|NP_216771.1| hypothetical protein Rv2255c [Mycob... 127 6e-28 >gi|15609392|ref|NP_216771.1| hypothetical protein Rv2255c [Mycobacterium tuberculosis H37Rv] gi|31793435|ref|NP_855928.1| hypothetical protein Mb2279c [Mycobacterium bovis AF2122/97] gi|121638138|ref|YP_978362.1| hypothetical protein BCG_2273c [Mycobacterium bovis BCG str. Pasteur 1173P2] 22 more sequence titlesLength=64 Score = 127 bits (319), Expect = 6e-28, Method: Compositional matrix adjust. Identities = 63/64 (99%), Positives = 64/64 (100%), Gaps = 0/64 (0%) Query 1 VDGIVDRGVRARPCQKVVAVLRRSKSHIDKRLDAATGNAFLGKQVLSAAGVVEYRPPRRS 60 +DGIVDRGVRARPCQKVVAVLRRSKSHIDKRLDAATGNAFLGKQVLSAAGVVEYRPPRRS Sbjct 1 MDGIVDRGVRARPCQKVVAVLRRSKSHIDKRLDAATGNAFLGKQVLSAAGVVEYRPPRRS 60 Query 61 PLST 64 PLST Sbjct 61 PLST 64 Lambda K H 0.321 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 130804070320 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40