BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2307D Length=60 Score E Sequences producing significant alignments: (Bits) Value gi|15841803|ref|NP_336840.1| hypothetical protein MT2365.2 [Myco... 120 5e-26 >gi|15841803|ref|NP_336840.1| hypothetical protein MT2365.2 [Mycobacterium tuberculosis CDC1551] gi|31793489|ref|NP_855982.1| hypothetical protein Mb2333c [Mycobacterium bovis AF2122/97] gi|57116966|ref|YP_177667.1| hypothetical protein Rv2307D [Mycobacterium tuberculosis H37Rv] 28 more sequence titlesLength=60 Score = 120 bits (302), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 60/60 (100%), Positives = 60/60 (100%), Gaps = 0/60 (0%) Query 1 MWRHLWLMQPQRRYPRGSGTTRTARRDAGVAPLYGVSRVTVLASTTATTAPPVKSFPDLL 60 MWRHLWLMQPQRRYPRGSGTTRTARRDAGVAPLYGVSRVTVLASTTATTAPPVKSFPDLL Sbjct 1 MWRHLWLMQPQRRYPRGSGTTRTARRDAGVAPLYGVSRVTVLASTTATTAPPVKSFPDLL 60 Lambda K H 0.321 0.132 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 127366071138 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40