BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 17,799,605 sequences; 6,109,862,990 total letters Query= Rv2395B Length=54 Score E Sequences producing significant alignments: (Bits) Value gi|15841911|ref|NP_336948.1| hypothetical protein MT2467 [Mycoba... 106 1e-21 gi|297634998|ref|ZP_06952778.1| hypothetical protein MtubK4_1278... 99.8 1e-19 gi|167968723|ref|ZP_02551000.1| hypothetical protein MtubH3_1206... 95.9 2e-18 >gi|15841911|ref|NP_336948.1| hypothetical protein MT2467 [Mycobacterium tuberculosis CDC1551] gi|289570543|ref|ZP_06450770.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|13882181|gb|AAK46762.1| hypothetical protein MT2467 [Mycobacterium tuberculosis CDC1551] gi|289544297|gb|EFD47945.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] Length=54 Score = 106 bits (265), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 53/54 (99%), Positives = 54/54 (100%), Gaps = 0/54 (0%) Query 1 VPGLVPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL 54 +PGLVPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL Sbjct 1 MPGLVPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL 54 >gi|297634998|ref|ZP_06952778.1| hypothetical protein MtubK4_12786 [Mycobacterium tuberculosis KZN 4207] gi|313659325|ref|ZP_07816205.1| hypothetical protein MtubKV_12928 [Mycobacterium tuberculosis KZN V2475] Length=50 Score = 99.8 bits (247), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 5 VPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL 54 +PAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL Sbjct 1 MPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL 50 >gi|167968723|ref|ZP_02551000.1| hypothetical protein MtubH3_12060 [Mycobacterium tuberculosis H37Ra] Length=47 Score = 95.9 bits (237), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%) Query 8 MPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL 54 MPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL Sbjct 1 MPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL 47 Lambda K H 0.315 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 151990388685 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Apr 10, 2012 4:41 PM Number of letters in database: 6,109,862,990 Number of sequences in database: 17,799,605 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40