BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2401A Length=67 Score E Sequences producing significant alignments: (Bits) Value gi|31793580|ref|NP_856073.1| hypothetical protein Mb2424c [Mycob... 129 1e-28 gi|15841918|ref|NP_336955.1| hypothetical protein MT2473 [Mycoba... 125 3e-27 gi|240169948|ref|ZP_04748607.1| hypothetical protein MkanA1_1159... 104 5e-21 gi|254818750|ref|ZP_05223751.1| hypothetical protein MintA_02439... 90.5 7e-17 gi|118618930|ref|YP_907262.1| hypothetical protein MUL_3662 [Myc... 89.7 1e-16 gi|15827251|ref|NP_301514.1| hypothetical protein ML0614 [Mycoba... 89.0 2e-16 gi|342857797|ref|ZP_08714453.1| hypothetical protein MCOL_02935 ... 87.8 5e-16 gi|118463346|ref|YP_881005.1| hypothetical protein MAV_1781 [Myc... 87.0 9e-16 gi|41408312|ref|NP_961148.1| hypothetical protein MAP2214c [Myco... 85.9 2e-15 gi|120404834|ref|YP_954663.1| hypothetical protein Mvan_3876 [My... 82.4 2e-14 gi|145223264|ref|YP_001133942.1| hypothetical protein Mflv_2677 ... 82.4 2e-14 gi|315443724|ref|YP_004076603.1| hypothetical protein Mspyr1_211... 80.9 6e-14 gi|333990151|ref|YP_004522765.1| hypothetical protein JDM601_151... 79.7 1e-13 gi|118467547|ref|YP_888806.1| hypothetical protein MSMEG_4534 [M... 74.7 4e-12 gi|108800449|ref|YP_640646.1| hypothetical protein Mmcs_3483 [My... 71.6 4e-11 gi|169628741|ref|YP_001702390.1| hypothetical protein MAB_1651 [... 63.9 8e-09 gi|296170546|ref|ZP_06852130.1| conserved hypothetical protein [... 63.2 1e-08 gi|326381596|ref|ZP_08203290.1| hypothetical protein SCNU_01555 ... 57.0 1e-06 gi|333918852|ref|YP_004492433.1| hypothetical protein AS9A_1181 ... 53.9 8e-06 gi|312140311|ref|YP_004007647.1| membrane protein [Rhodococcus e... 46.6 0.001 gi|343926785|ref|ZP_08766278.1| hypothetical protein GOALK_072_0... 46.2 0.002 gi|54023370|ref|YP_117612.1| hypothetical protein nfa14030 [Noca... 45.4 0.003 gi|226360408|ref|YP_002778186.1| hypothetical protein ROP_09940 ... 44.7 0.005 gi|317506373|ref|ZP_07964184.1| GTP-binding protein [Segniliparu... 43.9 0.009 gi|111018285|ref|YP_701257.1| hypothetical protein RHA1_ro01275 ... 43.5 0.011 gi|262203065|ref|YP_003274273.1| hypothetical protein Gbro_3175 ... 43.5 0.011 gi|256375364|ref|YP_003099024.1| hypothetical protein Amir_1226 ... 42.0 0.034 gi|296393267|ref|YP_003658151.1| hypothetical protein Srot_0841 ... 40.8 0.075 gi|291007191|ref|ZP_06565164.1| hypothetical protein SeryN2_2193... 39.3 0.18 gi|134098046|ref|YP_001103707.1| hypothetical protein SACE_1460 ... 39.3 0.19 gi|226307244|ref|YP_002767204.1| hypothetical protein RER_37570 ... 38.1 0.42 gi|229493156|ref|ZP_04386948.1| conserved hypothetical protein [... 37.7 0.52 gi|331698294|ref|YP_004334533.1| hypothetical protein Psed_4526 ... 35.0 3.3 >gi|31793580|ref|NP_856073.1| hypothetical protein Mb2424c [Mycobacterium bovis AF2122/97] gi|57116985|ref|YP_177670.1| hypothetical protein Rv2401A [Mycobacterium tuberculosis H37Rv] gi|121638282|ref|YP_978506.1| hypothetical protein BCG_2417c [Mycobacterium bovis BCG str. Pasteur 1173P2] 74 more sequence titles Length=67 Score = 129 bits (325), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 66/67 (99%), Positives = 67/67 (100%), Gaps = 0/67 (0%) Query 1 VGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR 60 +GPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR Sbjct 1 MGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR 60 Query 61 RPDQAPR 67 RPDQAPR Sbjct 61 RPDQAPR 67 >gi|15841918|ref|NP_336955.1| hypothetical protein MT2473 [Mycobacterium tuberculosis CDC1551] gi|254365176|ref|ZP_04981222.1| conserved membrane protein [Mycobacterium tuberculosis str. Haarlem] gi|13882188|gb|AAK46769.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] gi|134150690|gb|EBA42735.1| conserved membrane protein [Mycobacterium tuberculosis str. Haarlem] Length=64 Score = 125 bits (313), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD Sbjct 1 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 60 Query 64 QAPR 67 QAPR Sbjct 61 QAPR 64 >gi|240169948|ref|ZP_04748607.1| hypothetical protein MkanA1_11594 [Mycobacterium kansasii ATCC 12478] Length=64 Score = 104 bits (259), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 50/64 (79%), Positives = 57/64 (90%), Gaps = 0/64 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 MNGFL+WWDGVELWLSGLPFALQALAVMPVVL LAY TAA+LDALLG+ I+++RR R D Sbjct 1 MNGFLNWWDGVELWLSGLPFALQALAVMPVVLGLAYITAAVLDALLGKGIKVMRRIRHSD 60 Query 64 QAPR 67 +AP Sbjct 61 EAPE 64 >gi|254818750|ref|ZP_05223751.1| hypothetical protein MintA_02439 [Mycobacterium intracellulare ATCC 13950] Length=64 Score = 90.5 bits (223), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 50/63 (80%), Gaps = 0/63 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 MN FL+WWDG ELWLSGLPF LQA+ VMPVVLA+AY T ALLD LLG+ I+L+RRAR Sbjct 1 MNAFLNWWDGNELWLSGLPFVLQAMVVMPVVLAVAYVTGALLDGLLGKGIELMRRARHVG 60 Query 64 QAP 66 + Sbjct 61 ETS 63 >gi|118618930|ref|YP_907262.1| hypothetical protein MUL_3662 [Mycobacterium ulcerans Agy99] gi|183983699|ref|YP_001851990.1| hypothetical protein MMAR_3719 [Mycobacterium marinum M] gi|118571040|gb|ABL05791.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] gi|183177025|gb|ACC42135.1| conserved hypothetical protein [Mycobacterium marinum M] Length=64 Score = 89.7 bits (221), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 43/63 (69%), Positives = 52/63 (83%), Gaps = 0/63 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M+G L+WWDGVELWLSGLPFALQAL VMPVVL +A +AA+LDALLG I+L++R R D Sbjct 1 MSGILNWWDGVELWLSGLPFALQALTVMPVVLGVALISAAILDALLGMGIELMQRVRHSD 60 Query 64 QAP 66 +A Sbjct 61 EAS 63 >gi|15827251|ref|NP_301514.1| hypothetical protein ML0614 [Mycobacterium leprae TN] gi|221229729|ref|YP_002503145.1| hypothetical protein MLBr_00614 [Mycobacterium leprae Br4923] gi|18202551|sp|Q49760.1|Y614_MYCLE RecName: Full=Uncharacterized protein ML0614 gi|466979|gb|AAA17165.1| B1937_F2_47 [Mycobacterium leprae] gi|13092800|emb|CAC30122.1| hypothetical protein [Mycobacterium leprae] gi|219932836|emb|CAR70707.1| hypothetical protein MLBr00614 [Mycobacterium leprae Br4923] Length=95 Score = 89.0 bits (219), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%) Query 1 VGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR 60 V P+NGFL+WWD +ELWLSGL F LQA VMPVVLA AY TA +LD LG+ IQL+RRA Sbjct 29 VSPVNGFLNWWDSIELWLSGLAFVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAY 88 Query 61 RPDQA 65 PD A Sbjct 89 HPDSA 93 >gi|342857797|ref|ZP_08714453.1| hypothetical protein MCOL_02935 [Mycobacterium colombiense CECT 3035] gi|342135130|gb|EGT88296.1| hypothetical protein MCOL_02935 [Mycobacterium colombiense CECT 3035] Length=67 Score = 87.8 bits (216), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 41/64 (65%), Positives = 50/64 (79%), Gaps = 0/64 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 +N FL+WWDG ELWLSGLPF LQA+ VMP+VLA+AY TAA+LD LG+ I+L+RRAR Sbjct 4 VNAFLNWWDGNELWLSGLPFVLQAMVVMPIVLAVAYATAAVLDGALGKGIELMRRARHAG 63 Query 64 QAPR 67 P Sbjct 64 GTPE 67 >gi|118463346|ref|YP_881005.1| hypothetical protein MAV_1781 [Mycobacterium avium 104] gi|118164633|gb|ABK65530.1| conserved hypothetical protein [Mycobacterium avium 104] gi|336458252|gb|EGO37233.1| hypothetical protein MAPs_15470 [Mycobacterium avium subsp. paratuberculosis S397] Length=64 Score = 87.0 bits (214), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 42/59 (72%), Positives = 49/59 (84%), Gaps = 0/59 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRP 62 MN FL+WWDG ELWLSGL F LQA+ VMP+VLA+AY TAALLD LLG+ I L+RRAR+ Sbjct 1 MNAFLNWWDGNELWLSGLAFVLQAMVVMPIVLAVAYVTAALLDGLLGKGIALMRRARQA 59 >gi|41408312|ref|NP_961148.1| hypothetical protein MAP2214c [Mycobacterium avium subsp. paratuberculosis K-10] gi|254774599|ref|ZP_05216115.1| hypothetical protein MaviaA2_08008 [Mycobacterium avium subsp. avium ATCC 25291] gi|41396668|gb|AAS04531.1| hypothetical protein MAP_2214c [Mycobacterium avium subsp. paratuberculosis K-10] Length=67 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 41/60 (69%), Positives = 49/60 (82%), Gaps = 0/60 (0%) Query 3 PMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRP 62 +N FL+WWDG ELWLSGL F LQA+ VMP+VLA+AY TAALLD LLG+ I L+RRAR+ Sbjct 3 SVNAFLNWWDGNELWLSGLAFVLQAMVVMPIVLAVAYVTAALLDGLLGKGIALMRRARQA 62 >gi|120404834|ref|YP_954663.1| hypothetical protein Mvan_3876 [Mycobacterium vanbaalenii PYR-1] gi|119957652|gb|ABM14657.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] Length=68 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 39/61 (64%), Positives = 46/61 (76%), Gaps = 0/61 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M+ FL+WWDGVELWLSGLPF Q + VMPVVLALAY TA +LD LLG I+++ R R D Sbjct 1 MDSFLNWWDGVELWLSGLPFLAQTVVVMPVVLALAYVTAVILDHLLGNGIRILHRIRHVD 60 Query 64 Q 64 Sbjct 61 D 61 >gi|145223264|ref|YP_001133942.1| hypothetical protein Mflv_2677 [Mycobacterium gilvum PYR-GCK] gi|145215750|gb|ABP45154.1| conserved hypothetical protein [Mycobacterium gilvum PYR-GCK] Length=68 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 42/65 (65%), Positives = 49/65 (76%), Gaps = 1/65 (1%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARR-P 62 M+GFL+WWD VELWLSGLPF Q L VMPVVLALA+ TA LLD LLG I+++ R R P Sbjct 1 MDGFLNWWDSVELWLSGLPFIAQTLVVMPVVLALAFGTAVLLDLLLGSSIRILHRIRHTP 60 Query 63 DQAPR 67 + A R Sbjct 61 EDAER 65 >gi|315443724|ref|YP_004076603.1| hypothetical protein Mspyr1_21140 [Mycobacterium sp. Spyr1] gi|315262027|gb|ADT98768.1| hypothetical protein Mspyr1_21140 [Mycobacterium sp. Spyr1] Length=68 Score = 80.9 bits (198), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 1/65 (1%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARR-P 62 M+GFL+WWD VELWLSGLPF Q L VMPVVLALA TA LLD LLG I+++ R R P Sbjct 1 MDGFLNWWDSVELWLSGLPFIAQTLVVMPVVLALALGTAVLLDLLLGSSIRILHRIRHTP 60 Query 63 DQAPR 67 + A R Sbjct 61 EDAER 65 >gi|333990151|ref|YP_004522765.1| hypothetical protein JDM601_1511 [Mycobacterium sp. JDM601] gi|333486119|gb|AEF35511.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=64 Score = 79.7 bits (195), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 40/64 (63%), Positives = 47/64 (74%), Gaps = 0/64 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M GFLSWWDGVELWLSGL F +Q VMPVVLALAY A +LDA+LG+ I+++ R R D Sbjct 1 MVGFLSWWDGVELWLSGLGFVIQTAVVMPVVLALAYILAVVLDAMLGQGIRVLERVRPDD 60 Query 64 QAPR 67 R Sbjct 61 GEAR 64 >gi|118467547|ref|YP_888806.1| hypothetical protein MSMEG_4534 [Mycobacterium smegmatis str. MC2 155] gi|118168834|gb|ABK69730.1| putative conserved membrane protein [Mycobacterium smegmatis str. MC2 155] Length=67 Score = 74.7 bits (182), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 36/63 (58%), Positives = 42/63 (67%), Gaps = 0/63 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M L+WWDGVELWL+GLPF Q VMPVVLALAY A +LD L + + +RR RR D Sbjct 1 MGALLNWWDGVELWLTGLPFLAQTAVVMPVVLALAYGIAVVLDGALAQAVHAVRRLRRAD 60 Query 64 QAP 66 A Sbjct 61 SAE 63 >gi|108800449|ref|YP_640646.1| hypothetical protein Mmcs_3483 [Mycobacterium sp. MCS] gi|119869578|ref|YP_939530.1| hypothetical protein Mkms_3546 [Mycobacterium sp. KMS] gi|126436073|ref|YP_001071764.1| hypothetical protein Mjls_3496 [Mycobacterium sp. JLS] gi|108770868|gb|ABG09590.1| conserved hypothetical protein [Mycobacterium sp. MCS] gi|119695667|gb|ABL92740.1| conserved hypothetical protein [Mycobacterium sp. KMS] gi|126235873|gb|ABN99273.1| conserved hypothetical protein [Mycobacterium sp. JLS] Length=64 Score = 71.6 bits (174), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 36/63 (58%), Positives = 42/63 (67%), Gaps = 0/63 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M+ FLSWWDGVELWL+GL F Q VMPV L LAY A LLD L ++++RRAR Sbjct 1 MDAFLSWWDGVELWLTGLGFVAQTAVVMPVALLLAYGLAVLLDGALAAGVRVLRRARHDG 60 Query 64 QAP 66 Q P Sbjct 61 QEP 63 >gi|169628741|ref|YP_001702390.1| hypothetical protein MAB_1651 [Mycobacterium abscessus ATCC 19977] gi|169240708|emb|CAM61736.1| Conserved hypothetical protein [Mycobacterium abscessus] Length=86 Score = 63.9 bits (154), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 0/62 (0%) Query 6 GFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPDQA 65 G LSWWDGVELWLSG F LQ + VMPVVLALAY A D +L ++ ++ R R A Sbjct 8 GILSWWDGVELWLSGRGFILQTIIVMPVVLALAYVMAVTGDKILFLLLSMVNRLGRFSPA 67 Query 66 PR 67 R Sbjct 68 AR 69 >gi|296170546|ref|ZP_06852130.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295894778|gb|EFG74503.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=64 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M FLSWWDG ELWLSGL F LQA+ VMPVVL +A TA LLD LLG+ I L+RRAR Sbjct 1 MTAFLSWWDGNELWLSGLAFVLQAMVVMPVVLVVAAVTAGLLDGLLGKSIALMRRARHAG 60 Query 64 QAP 66 +AP Sbjct 61 EAP 63 >gi|326381596|ref|ZP_08203290.1| hypothetical protein SCNU_01555 [Gordonia neofelifaecis NRRL B-59395] gi|326199843|gb|EGD57023.1| hypothetical protein SCNU_01555 [Gordonia neofelifaecis NRRL B-59395] Length=66 Score = 57.0 bits (136), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/61 (48%), Positives = 38/61 (63%), Gaps = 0/61 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 MNG LSWWDGVE WL+GLPF Q L V++ LA A+ ++ L+GR+ + RA D Sbjct 1 MNGVLSWWDGVEEWLTGLPFIPQLLVTAIVLVPLATLAASGVNYLVGRLFSKLGRAEADD 60 Query 64 Q 64 Sbjct 61 D 61 >gi|333918852|ref|YP_004492433.1| hypothetical protein AS9A_1181 [Amycolicicoccus subflavus DQS3-9A1] gi|333481073|gb|AEF39633.1| hypothetical protein AS9A_1181 [Amycolicicoccus subflavus DQS3-9A1] Length=77 Score = 53.9 bits (128), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 25/58 (44%), Positives = 38/58 (66%), Gaps = 0/58 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARR 61 M+ WWDGVELW++GLPF Q + V+ V++ L + A +LD +LG + + + R RR Sbjct 1 MDAIARWWDGVELWIAGLPFIPQVILVVAVMVPLCFVFATVLDRVLGPLFERLDRPRR 58 >gi|312140311|ref|YP_004007647.1| membrane protein [Rhodococcus equi 103S] gi|325677115|ref|ZP_08156784.1| hypothetical protein HMPREF0724_14567 [Rhodococcus equi ATCC 33707] gi|311889650|emb|CBH48967.1| putative membrane protein [Rhodococcus equi 103S] gi|325552100|gb|EGD21793.1| hypothetical protein HMPREF0724_14567 [Rhodococcus equi ATCC 33707] Length=74 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 23/57 (41%), Positives = 34/57 (60%), Gaps = 0/57 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR 60 M+ +WWDG ELW++GLPF Q L V+ V++ + A +LD +L V + RA Sbjct 1 MDQLANWWDGAELWIAGLPFIPQVLLVLAVMIPACFGIAWMLDRVLSAVFAAVGRAE 57 >gi|343926785|ref|ZP_08766278.1| hypothetical protein GOALK_072_00060 [Gordonia alkanivorans NBRC 16433] gi|343763145|dbj|GAA13204.1| hypothetical protein GOALK_072_00060 [Gordonia alkanivorans NBRC 16433] Length=66 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/61 (40%), Positives = 32/61 (53%), Gaps = 0/61 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M F +WWDGVE WL+GL F Q L + VV+ +A A +L+ L+ L R D Sbjct 1 MTAFFAWWDGVEEWLTGLSFVPQLLVTVAVVIPVAILIAYVLNLLVDLAATLFDRRHFAD 60 Query 64 Q 64 Sbjct 61 D 61 >gi|54023370|ref|YP_117612.1| hypothetical protein nfa14030 [Nocardia farcinica IFM 10152] gi|54014878|dbj|BAD56248.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=85 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 24/58 (42%), Positives = 36/58 (63%), Gaps = 0/58 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARR 61 M+ WWDG ELW++GLPF Q L V+ ++ +++ A LLD L ++L+ R RR Sbjct 1 MDRIAGWWDGFELWVAGLPFIPQFLVVLVGMVPVSFAIAYLLDRGLRACLRLLGRDRR 58 >gi|226360408|ref|YP_002778186.1| hypothetical protein ROP_09940 [Rhodococcus opacus B4] gi|226238893|dbj|BAH49241.1| hypothetical membrane protein [Rhodococcus opacus B4] Length=63 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 26/63 (42%), Positives = 35/63 (56%), Gaps = 0/63 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPD 63 M+ SWWDG ELW++GLPF Q V+ V++ + A LLD L V L+RR Sbjct 1 MDRMASWWDGFELWIAGLPFVPQVALVLLVMVPVCRGLAWLLDRGLAAVFVLLRRDVSKV 60 Query 64 QAP 66 + P Sbjct 61 EEP 63 >gi|317506373|ref|ZP_07964184.1| GTP-binding protein [Segniliparus rugosus ATCC BAA-974] gi|316255336|gb|EFV14595.1| GTP-binding protein [Segniliparus rugosus ATCC BAA-974] Length=90 Score = 43.9 bits (102), Expect = 0.009, Method: Compositional matrix adjust. Identities = 21/46 (46%), Positives = 30/46 (66%), Gaps = 0/46 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALL 49 M L WWDGVELW++G F Q + ++ VV+ LA+ TA LD ++ Sbjct 4 MEQVLRWWDGVELWVAGQGFVPQVVLMLAVVIPLAWLTAGALDRVI 49 >gi|111018285|ref|YP_701257.1| hypothetical protein RHA1_ro01275 [Rhodococcus jostii RHA1] gi|110817815|gb|ABG93099.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length=60 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 25/58 (44%), Positives = 33/58 (57%), Gaps = 0/58 (0%) Query 9 SWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPDQAP 66 SWWDG ELW++GLPF Q V+ V++ + A LLD L V L+RR + P Sbjct 3 SWWDGFELWIAGLPFVPQVALVLLVMVPVCRGLAWLLDRGLAAVFVLLRRDVSKVEEP 60 >gi|262203065|ref|YP_003274273.1| hypothetical protein Gbro_3175 [Gordonia bronchialis DSM 43247] gi|262086412|gb|ACY22380.1| hypothetical protein Gbro_3175 [Gordonia bronchialis DSM 43247] Length=73 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 27/64 (43%), Positives = 37/64 (58%), Gaps = 0/64 (0%) Query 1 VGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR 60 V + GF +WWD VE WL+GL F Q L + VV+ +A TA L+ L+ V+ L+ R R Sbjct 5 VDRVTGFFAWWDSVEEWLTGLSFVPQLLVTLAVVVPVAIITAFALNLLVDGVLGLLDRRR 64 Query 61 RPDQ 64 D Sbjct 65 FVDD 68 >gi|256375364|ref|YP_003099024.1| hypothetical protein Amir_1226 [Actinosynnema mirum DSM 43827] gi|255919667|gb|ACU35178.1| hypothetical protein Amir_1226 [Actinosynnema mirum DSM 43827] Length=82 Score = 42.0 bits (97), Expect = 0.034, Method: Compositional matrix adjust. Identities = 22/43 (52%), Positives = 25/43 (59%), Gaps = 0/43 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLD 46 M WWDGVELWL+ LPF LQ VM V+L A A +D Sbjct 1 MESIARWWDGVELWLAQLPFFLQFPLVMAVLLPAALGVARFID 43 >gi|296393267|ref|YP_003658151.1| hypothetical protein Srot_0841 [Segniliparus rotundus DSM 44985] gi|296180414|gb|ADG97320.1| hypothetical protein Srot_0841 [Segniliparus rotundus DSM 44985] Length=87 Score = 40.8 bits (94), Expect = 0.075, Method: Compositional matrix adjust. Identities = 19/48 (40%), Positives = 28/48 (59%), Gaps = 0/48 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGR 51 M L WWDGVELW++G F Q + ++ + LA+F A LD ++ Sbjct 1 MEQALRWWDGVELWVAGQGFVPQVVLILAAAVPLAWFAAGALDRVVSH 48 >gi|291007191|ref|ZP_06565164.1| hypothetical protein SeryN2_21932 [Saccharopolyspora erythraea NRRL 2338] Length=91 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 3/62 (4%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLD---ALLGRVIQLIRRAR 60 M + WWD ELWL LP+ LQ + V+ V++ LA+ L+D LG + +R A Sbjct 16 MEWLVEWWDAAELWLVQLPYPLQVMLVLAVLVPLAWGVGWLIDRGIDALGAKLTRVRDAE 75 Query 61 RP 62 P Sbjct 76 PP 77 >gi|134098046|ref|YP_001103707.1| hypothetical protein SACE_1460 [Saccharopolyspora erythraea NRRL 2338] gi|133910669|emb|CAM00782.1| hypothetical protein SACE_1460 [Saccharopolyspora erythraea NRRL 2338] Length=77 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 3/62 (4%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLD---ALLGRVIQLIRRAR 60 M + WWD ELWL LP+ LQ + V+ V++ LA+ L+D LG + +R A Sbjct 2 MEWLVEWWDAAELWLVQLPYPLQVMLVLAVLVPLAWGVGWLIDRGIDALGAKLTRVRDAE 61 Query 61 RP 62 P Sbjct 62 PP 63 >gi|226307244|ref|YP_002767204.1| hypothetical protein RER_37570 [Rhodococcus erythropolis PR4] gi|226186361|dbj|BAH34465.1| hypothetical protein RER_37570 [Rhodococcus erythropolis PR4] Length=68 Score = 38.1 bits (87), Expect = 0.42, Method: Compositional matrix adjust. Identities = 19/44 (44%), Positives = 24/44 (55%), Gaps = 0/44 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDA 47 M+ WWD ELW++GLPF Q V+ VV+ L A LD Sbjct 1 MDRIADWWDSFELWMAGLPFIPQVALVLIVVVPLCRLVAIGLDC 44 >gi|229493156|ref|ZP_04386948.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|229319887|gb|EEN85716.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length=68 Score = 37.7 bits (86), Expect = 0.52, Method: Compositional matrix adjust. Identities = 19/43 (45%), Positives = 24/43 (56%), Gaps = 0/43 (0%) Query 4 MNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLD 46 M+ WWD ELW++GLPF Q V+ VV+ L A LD Sbjct 1 MDRIADWWDSFELWMAGLPFIPQVALVLIVVVPLCRLVAIGLD 43 >gi|331698294|ref|YP_004334533.1| hypothetical protein Psed_4526 [Pseudonocardia dioxanivorans CB1190] gi|326952983|gb|AEA26680.1| hypothetical protein Psed_4526 [Pseudonocardia dioxanivorans CB1190] Length=85 Score = 35.0 bits (79), Expect = 3.3, Method: Compositional matrix adjust. Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 3/62 (4%) Query 9 SWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQL---IRRARRPDQA 65 WWD VELW++ L F LQ + VVL + A L+D + G V + + RA RP +A Sbjct 3 DWWDAVELWVTQLAFPLQVVLAAVVVLPVCAGLAILVDRVSGVVETIYDALPRANRPGRA 62 Query 66 PR 67 P Sbjct 63 PE 64 Lambda K H 0.329 0.143 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 129524807608 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40