BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2644c Length=105 Score E Sequences producing significant alignments: (Bits) Value gi|15609781|ref|NP_217160.1| hypothetical protein Rv2644c [Mycob... 216 1e-54 gi|340627665|ref|YP_004746117.1| hypothetical protein MCAN_26901... 214 3e-54 gi|258654538|ref|YP_003203694.1| transcription elongation factor... 34.7 4.9 >gi|15609781|ref|NP_217160.1| hypothetical protein Rv2644c [Mycobacterium tuberculosis H37Rv] gi|31793830|ref|NP_856323.1| hypothetical protein Mb2677c [Mycobacterium bovis AF2122/97] gi|121638533|ref|YP_978757.1| hypothetical protein BCG_2671c [Mycobacterium bovis BCG str. Pasteur 1173P2] 20 more sequence titlesLength=105 Score = 216 bits (550), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 105/105 (100%), Positives = 105/105 (100%), Gaps = 0/105 (0%) Query 1 MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTS 60 MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTS Sbjct 1 MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTS 60 Query 61 LPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHAG 105 LPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHAG Sbjct 61 LPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHAG 105 >gi|340627665|ref|YP_004746117.1| hypothetical protein MCAN_26901 [Mycobacterium canettii CIPT 140010059] gi|340005855|emb|CCC45021.1| hypothetical protein MCAN_26901 [Mycobacterium canettii CIPT 140010059] Length=105 Score = 214 bits (546), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%) Query 1 MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTS 60 MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTS Sbjct 1 MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTS 60 Query 61 LPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHAG 105 LPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALH G Sbjct 61 LPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHTG 105 >gi|258654538|ref|YP_003203694.1| transcription elongation factor GreA [Nakamurella multipartita DSM 44233] gi|258557763|gb|ACV80705.1| transcription elongation factor GreA [Nakamurella multipartita DSM 44233] Length=163 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 17/57 (30%), Positives = 30/57 (53%), Gaps = 1/57 (1%) Query 9 GVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTSLPQPL 65 GV P D ++ G++V + + G D+ + T + VH G+ +Y PQ+ L Q + Sbjct 77 GVAPADDGVVEPGMVVTIAYDGDDDDKETFLLGSREEGVH-GSMPVYSPQSPLGQAI 132 Lambda K H 0.322 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131458853568 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40