BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2806 Length=63 Score E Sequences producing significant alignments: (Bits) Value gi|15609943|ref|NP_217322.1| hypothetical protein Rv2806 [Mycoba... 128 3e-28 gi|340627806|ref|YP_004746258.1| hypothetical protein MCAN_28331... 127 7e-28 gi|289570986|ref|ZP_06451213.1| membrane protein [Mycobacterium ... 100 1e-19 gi|118464878|ref|YP_881459.1| hypothetical protein MAV_2255 [Myc... 93.6 9e-18 gi|118619576|ref|YP_907908.1| hypothetical protein MUL_4459 [Myc... 73.9 8e-12 gi|183984575|ref|YP_001852866.1| hypothetical protein MMAR_4608 ... 70.1 1e-10 gi|118465172|ref|YP_879972.1| hypothetical protein MAV_0693 [Myc... 48.9 3e-04 gi|342858513|ref|ZP_08715168.1| hypothetical protein MCOL_06546 ... 47.0 9e-04 >gi|15609943|ref|NP_217322.1| hypothetical protein Rv2806 [Mycobacterium tuberculosis H37Rv] gi|15842343|ref|NP_337380.1| hypothetical protein MT2873 [Mycobacterium tuberculosis CDC1551] gi|31793982|ref|NP_856475.1| hypothetical protein Mb2829 [Mycobacterium bovis AF2122/97] 74 more sequence titlesLength=63 Score = 128 bits (321), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 62/63 (99%), Positives = 63/63 (100%), Gaps = 0/63 (0%) Query 1 VKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI 60 +KTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI Sbjct 1 MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI 60 Query 61 NRQ 63 NRQ Sbjct 61 NRQ 63 >gi|340627806|ref|YP_004746258.1| hypothetical protein MCAN_28331 [Mycobacterium canettii CIPT 140010059] gi|340005996|emb|CCC45164.1| putative membrane protein [Mycobacterium canettii CIPT 140010059] Length=63 Score = 127 bits (318), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%) Query 1 VKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI 60 +KTNPRYGPAFY+VMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI Sbjct 1 MKTNPRYGPAFYAVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI 60 Query 61 NRQ 63 NRQ Sbjct 61 NRQ 63 >gi|289570986|ref|ZP_06451213.1| membrane protein [Mycobacterium tuberculosis T17] gi|289544740|gb|EFD48388.1| membrane protein [Mycobacterium tuberculosis T17] Length=50 Score = 100 bits (248), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Query 14 VMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ 63 +MTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ Sbjct 1 MMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ 50 >gi|118464878|ref|YP_881459.1| hypothetical protein MAV_2255 [Mycobacterium avium 104] gi|118166165|gb|ABK67062.1| putative membrane protein [Mycobacterium avium 104] Length=63 Score = 93.6 bits (231), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 45/63 (72%), Positives = 52/63 (83%), Gaps = 0/63 (0%) Query 1 VKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHI 60 +KTNPRY AFY+VM+VL LALFVLNVCTHG+ LGLI TGGLAV+MGY YR W GKR Sbjct 1 MKTNPRYLAAFYTVMSVLSLALFVLNVCTHGTMLGLIGTGGLAVVMGYNAYRAWFGKRRT 60 Query 61 NRQ 63 ++Q Sbjct 61 SQQ 63 >gi|118619576|ref|YP_907908.1| hypothetical protein MUL_4459 [Mycobacterium ulcerans Agy99] gi|118571686|gb|ABL06437.1| conserved hypothetical membrane protein [Mycobacterium ulcerans Agy99] Length=77 Score = 73.9 bits (180), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 37/59 (63%), Positives = 42/59 (72%), Gaps = 3/59 (5%) Query 5 PRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ 63 P+Y FY+ M+ L L LFV+NVC+HGS LGLISTGGLAVLM R WS KRH N Q Sbjct 22 PQYSATFYAAMSGLALVLFVINVCSHGSALGLISTGGLAVLM---VCRAWSAKRHRNHQ 77 >gi|183984575|ref|YP_001852866.1| hypothetical protein MMAR_4608 [Mycobacterium marinum M] gi|183177901|gb|ACC43011.1| conserved hypothetical membrane protein [Mycobacterium marinum M] Length=77 Score = 70.1 bits (170), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 36/59 (62%), Positives = 41/59 (70%), Gaps = 3/59 (5%) Query 5 PRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ 63 P+Y FY+ M+ L L FV+NVC+HGS LGLISTGGLAVLM R WS KRH N Q Sbjct 22 PQYSATFYAAMSGLALVPFVINVCSHGSALGLISTGGLAVLM---VCRAWSAKRHRNYQ 77 >gi|118465172|ref|YP_879972.1| hypothetical protein MAV_0693 [Mycobacterium avium 104] gi|118166459|gb|ABK67356.1| putative membrane protein [Mycobacterium avium 104] Length=39 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%) Query 30 HGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ 63 HG+ LGLI TGGLA LMGY YR W KRH +RQ Sbjct 6 HGTWLGLICTGGLAELMGYNAYRAWFAKRHQSRQ 39 >gi|342858513|ref|ZP_08715168.1| hypothetical protein MCOL_06546 [Mycobacterium colombiense CECT 3035] gi|342134217|gb|EGT87397.1| hypothetical protein MCOL_06546 [Mycobacterium colombiense CECT 3035] Length=50 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 23/29 (80%), Positives = 24/29 (83%), Gaps = 0/29 (0%) Query 30 HGSTLGLISTGGLAVLMGYIGYRGWSGKR 58 HG+ LGLISTGGLAVLMGY YR W GKR Sbjct 20 HGTWLGLISTGGLAVLMGYNAYRAWFGKR 48 Lambda K H 0.327 0.143 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131230491224 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40