BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2808 Length=85 Score E Sequences producing significant alignments: (Bits) Value gi|15842345|ref|NP_337382.1| hypothetical protein MT2875 [Mycoba... 176 2e-42 gi|15609945|ref|NP_217324.1| hypothetical protein Rv2808 [Mycoba... 174 5e-42 gi|240173505|ref|ZP_04752163.1| hypothetical protein MkanA1_2961... 167 3e-40 gi|118616853|ref|YP_905185.1| hypothetical protein MUL_1132 [Myc... 116 1e-24 >gi|15842345|ref|NP_337382.1| hypothetical protein MT2875 [Mycobacterium tuberculosis CDC1551] gi|253798107|ref|YP_003031108.1| hypothetical protein TBMG_01165 [Mycobacterium tuberculosis KZN 1435] gi|254551870|ref|ZP_05142317.1| hypothetical protein Mtube_15662 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] 29 more sequence titlesLength=89 Score = 176 bits (445), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%) Query 1 VSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD 60 VSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD Sbjct 5 VSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD 64 Query 61 WVPNDYGLKIERAIDAYLETWPIYR 85 WVPNDYGLKIERAIDAYLETWPIYR Sbjct 65 WVPNDYGLKIERAIDAYLETWPIYR 89 >gi|15609945|ref|NP_217324.1| hypothetical protein Rv2808 [Mycobacterium tuberculosis H37Rv] gi|31793984|ref|NP_856477.1| hypothetical protein Mb2831 [Mycobacterium bovis AF2122/97] gi|121638688|ref|YP_978912.1| hypothetical protein BCG_2826 [Mycobacterium bovis BCG str. Pasteur 1173P2] 44 more sequence titles Length=85 Score = 174 bits (440), Expect = 5e-42, Method: Compositional matrix adjust. Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%) Query 1 VSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD 60 +SNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD Sbjct 1 MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD 60 Query 61 WVPNDYGLKIERAIDAYLETWPIYR 85 WVPNDYGLKIERAIDAYLETWPIYR Sbjct 61 WVPNDYGLKIERAIDAYLETWPIYR 85 >gi|240173505|ref|ZP_04752163.1| hypothetical protein MkanA1_29611 [Mycobacterium kansasii ATCC 12478] Length=85 Score = 167 bits (424), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 81/85 (96%), Positives = 82/85 (97%), Gaps = 0/85 (0%) Query 1 VSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD 60 +SNVLDAIS EHRPVI QELENRNPALFDELRRTEKPTNEQSDAVID LSDALMKTFGPD Sbjct 1 MSNVLDAISPEHRPVIAQELENRNPALFDELRRTEKPTNEQSDAVIDALSDALMKTFGPD 60 Query 61 WVPNDYGLKIERAIDAYLETWPIYR 85 WVPNDYGLKIERAIDAYLETWPIYR Sbjct 61 WVPNDYGLKIERAIDAYLETWPIYR 85 >gi|118616853|ref|YP_905185.1| hypothetical protein MUL_1132 [Mycobacterium ulcerans Agy99] gi|183980510|ref|YP_001848801.1| hypothetical protein MMAR_0481 [Mycobacterium marinum M] gi|118568963|gb|ABL03714.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] gi|183173836|gb|ACC38946.1| conserved hypothetical protein [Mycobacterium marinum M] Length=89 Score = 116 bits (290), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 54/85 (64%), Positives = 64/85 (76%), Gaps = 0/85 (0%) Query 1 VSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPD 60 V+N+LD + +EHR +I EL RNP L ELR +KPTN+QSDAV+D LS AL +GP Sbjct 5 VNNILDVVPSEHRVLIMDELTRRNPDLLAELRTVQKPTNDQSDAVVDALSHALSANYGPG 64 Query 61 WVPNDYGLKIERAIDAYLETWPIYR 85 VPNDYGL +ERAIDAYLE WPIYR Sbjct 65 HVPNDYGLAVERAIDAYLEAWPIYR 89 Lambda K H 0.315 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131466506940 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40