BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2862A Length=82 Score E Sequences producing significant alignments: (Bits) Value gi|253798049|ref|YP_003031050.1| antitoxin [Mycobacterium tuberc... 159 2e-37 gi|15842405|ref|NP_337442.1| hypothetical protein MT2931 [Mycoba... 128 2e-28 gi|298293362|ref|YP_003695301.1| hypothetical protein Snov_3408 ... 33.9 8.9 >gi|253798049|ref|YP_003031050.1| antitoxin [Mycobacterium tuberculosis KZN 1435] gi|308371160|ref|ZP_07424016.2| antitoxin [Mycobacterium tuberculosis SUMu003] gi|308372281|ref|ZP_07428056.2| antitoxin [Mycobacterium tuberculosis SUMu004] 12 more sequence titlesLength=82 Score = 159 bits (401), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 81/82 (99%), Positives = 82/82 (100%), Gaps = 0/82 (0%) Query 1 ILSDEEREAFRQQAAAQQMSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGA 60 +LSDEEREAFRQQAAAQQMSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGA Sbjct 1 MLSDEEREAFRQQAAAQQMSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGA 60 Query 61 EPDWQAHLQVMAESRRRGLPAP 82 EPDWQAHLQVMAESRRRGLPAP Sbjct 61 EPDWQAHLQVMAESRRRGLPAP 82 >gi|15842405|ref|NP_337442.1| hypothetical protein MT2931 [Mycobacterium tuberculosis CDC1551] gi|167969491|ref|ZP_02551768.1| hypothetical protein MtubH3_16281 [Mycobacterium tuberculosis H37Ra] gi|254551931|ref|ZP_05142378.1| antitoxin [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] 24 more sequence titles Length=64 Score = 128 bits (322), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%) Query 19 MSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGAEPDWQAHLQVMAESRRRG 78 MSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGAEPDWQAHLQVMAESRRRG Sbjct 1 MSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGAEPDWQAHLQVMAESRRRG 60 Query 79 LPAP 82 LPAP Sbjct 61 LPAP 64 >gi|298293362|ref|YP_003695301.1| hypothetical protein Snov_3408 [Starkeya novella DSM 506] gi|296929873|gb|ADH90682.1| conserved hypothetical protein [Starkeya novella DSM 506] Length=944 Score = 33.9 bits (76), Expect = 8.9, Method: Compositional matrix adjust. Identities = 21/56 (38%), Positives = 31/56 (56%), Gaps = 3/56 (5%) Query 30 LRQLEAQRQRPLRTAQELREFFASRPDETGAEPDWQAHLQVMAESRRR---GLPAP 82 L +L+ + + P R A L + ASRPD+ A W+AH+ M+ R GLP+P Sbjct 118 LSRLDRESRMPHRPATALADHLASRPDDPVAAALWRAHISRMSGQLGRLRAGLPSP 173 Lambda K H 0.317 0.127 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 127967590486 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40