BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2908c Length=80 Score E Sequences producing significant alignments: (Bits) Value gi|15610045|ref|NP_217424.1| hypothetical protein Rv2908c [Mycob... 148 2e-34 gi|41409074|ref|NP_961910.1| hypothetical protein MAP2976c [Myco... 145 2e-33 gi|120403180|ref|YP_953009.1| hypothetical protein Mvan_2188 [My... 145 2e-33 gi|108798934|ref|YP_639131.1| hypothetical protein Mmcs_1966 [My... 144 5e-33 gi|254776208|ref|ZP_05217724.1| hypothetical protein MaviaA2_162... 143 9e-33 gi|336459033|gb|EGO37983.1| putative RNA-binding protein (contai... 142 1e-32 gi|54026127|ref|YP_120369.1| hypothetical protein nfa41560 [Noca... 142 2e-32 gi|226305932|ref|YP_002765892.1| hypothetical protein RER_24450 ... 140 5e-32 gi|111023495|ref|YP_706467.1| hypothetical protein RHA1_ro06536 ... 139 2e-31 gi|312139213|ref|YP_004006549.1| RNA binding protein [Rhodococcu... 138 3e-31 gi|118468387|ref|YP_886776.1| hypothetical protein MSMEG_2436 [M... 137 4e-31 gi|333991270|ref|YP_004523884.1| hypothetical protein JDM601_263... 135 2e-30 gi|169630309|ref|YP_001703958.1| hypothetical protein MAB_3228c ... 135 2e-30 gi|333919235|ref|YP_004492816.1| hypothetical protein AS9A_1567 ... 134 3e-30 gi|326382873|ref|ZP_08204563.1| hypothetical protein SCNU_08038 ... 134 6e-30 gi|296139335|ref|YP_003646578.1| hypothetical protein Tpau_1618 ... 132 2e-29 gi|343925314|ref|ZP_08764839.1| hypothetical protein GOALK_040_0... 131 3e-29 gi|262202021|ref|YP_003273229.1| hypothetical protein Gbro_2084 ... 130 5e-29 gi|134102489|ref|YP_001108150.1| hypothetical protein SACE_6052 ... 128 4e-28 gi|256379919|ref|YP_003103579.1| hypothetical protein Amir_5925 ... 125 2e-27 gi|257055028|ref|YP_003132860.1| hypothetical protein Svir_09760... 124 4e-27 gi|15827852|ref|NP_302115.1| hypothetical protein ML1617 [Mycoba... 121 3e-26 gi|284992390|ref|YP_003410944.1| hypothetical protein Gobs_4007 ... 112 1e-23 gi|312194950|ref|YP_004015011.1| hypothetical protein FraEuI1c_1... 111 3e-23 gi|258653301|ref|YP_003202457.1| KH domain-containing protein [N... 111 4e-23 gi|296394374|ref|YP_003659258.1| hypothetical protein Srot_1970 ... 110 7e-23 gi|317508407|ref|ZP_07966077.1| hypothetical protein HMPREF9336_... 110 8e-23 gi|158313001|ref|YP_001505509.1| hypothetical protein Franean1_1... 110 8e-23 gi|336179499|ref|YP_004584874.1| hypothetical protein FsymDg_367... 109 1e-22 gi|300783878|ref|YP_003764169.1| RNA-binding protein [Amycolatop... 107 5e-22 gi|86742274|ref|YP_482674.1| hypothetical protein Francci3_3593 ... 107 6e-22 gi|345009609|ref|YP_004811963.1| hypothetical protein Strvi_1948... 106 1e-21 gi|182435681|ref|YP_001823400.1| hypothetical protein SGR_1888 [... 106 1e-21 gi|254393819|ref|ZP_05008931.1| conserved hypothetical protein [... 105 2e-21 gi|297191793|ref|ZP_06909191.1| UPF0109 protein [Streptomyces pr... 105 2e-21 gi|297156875|gb|ADI06587.1| hypothetical protein SBI_03466 [Stre... 104 4e-21 gi|331698506|ref|YP_004334745.1| hypothetical protein Psed_4745 ... 104 4e-21 gi|320008294|gb|ADW03144.1| hypothetical protein Sfla_1708 [Stre... 104 6e-21 gi|291454412|ref|ZP_06593802.1| UPF0109 protein [Streptomyces al... 103 6e-21 gi|254382007|ref|ZP_04997369.1| conserved hypothetical protein [... 103 7e-21 gi|295836291|ref|ZP_06823224.1| RNA-binding protein [Streptomyce... 103 7e-21 gi|297202647|ref|ZP_06920044.1| conserved hypothetical protein [... 103 8e-21 gi|345002323|ref|YP_004805177.1| hypothetical protein SACTE_4811... 103 1e-20 gi|302522158|ref|ZP_07274500.1| conserved hypothetical protein [... 103 1e-20 gi|302558142|ref|ZP_07310484.1| RNA-binding protein [Streptomyce... 102 2e-20 gi|145593857|ref|YP_001158154.1| hypothetical protein Strop_1306... 102 2e-20 gi|21223947|ref|NP_629726.1| hypothetical protein SCO5592 [Strep... 102 2e-20 gi|337768417|emb|CCB77130.1| conserved protein of unknown functi... 102 3e-20 gi|294631645|ref|ZP_06710205.1| RNA-binding protein [Streptomyce... 101 4e-20 gi|29829185|ref|NP_823819.1| hypothetical protein SAV_2643 [Stre... 100 5e-20 >gi|15610045|ref|NP_217424.1| hypothetical protein Rv2908c [Mycobacterium tuberculosis H37Rv] gi|15842451|ref|NP_337488.1| hypothetical protein MT2976 [Mycobacterium tuberculosis CDC1551] gi|31794084|ref|NP_856577.1| hypothetical protein Mb2932c [Mycobacterium bovis AF2122/97] 78 more sequence titles Length=80 Score = 148 bits (374), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRGIRVDVVDTDQ Sbjct 61 TLVAGIGGRGIRVDVVDTDQ 80 >gi|41409074|ref|NP_961910.1| hypothetical protein MAP2976c [Mycobacterium avium subsp. paratuberculosis K-10] gi|118462639|ref|YP_882935.1| hypothetical protein MAV_3763 [Mycobacterium avium 104] gi|118617622|ref|YP_905954.1| hypothetical protein MUL_2048 [Mycobacterium ulcerans Agy99] 11 more sequence titles Length=80 Score = 145 bits (366), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 77/80 (97%), Positives = 79/80 (99%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS VVVDAVEHLVRGIVDNPDDVRVD++TSRRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSTVVVDAVEHLVRGIVDNPDDVRVDMVTSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRGIRVDVVDTDQ Sbjct 61 TLVAGIGGRGIRVDVVDTDQ 80 >gi|120403180|ref|YP_953009.1| hypothetical protein Mvan_2188 [Mycobacterium vanbaalenii PYR-1] gi|119955998|gb|ABM13003.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] Length=80 Score = 145 bits (365), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 76/80 (95%), Positives = 80/80 (100%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS+VVVDAVEHLVRGIVDNPDDVRVD++T+RRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSSVVVDAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRGIRVDVVDTDQ Sbjct 61 TLVAGIGGRGIRVDVVDTDQ 80 >gi|108798934|ref|YP_639131.1| hypothetical protein Mmcs_1966 [Mycobacterium sp. MCS] gi|119868049|ref|YP_938001.1| hypothetical protein Mkms_2012 [Mycobacterium sp. KMS] gi|126434534|ref|YP_001070225.1| hypothetical protein Mjls_1946 [Mycobacterium sp. JLS] 7 more sequence titles Length=80 Score = 144 bits (362), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 75/80 (94%), Positives = 80/80 (100%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS+VVVDAVEHLVRGIVDNPDDVRVD++T+RRGRTVEVHVHP+DLGKVIGRGGRTATALR Sbjct 1 MSSVVVDAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPEDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRGIRVDVVDTDQ Sbjct 61 TLVAGIGGRGIRVDVVDTDQ 80 >gi|254776208|ref|ZP_05217724.1| hypothetical protein MaviaA2_16268 [Mycobacterium avium subsp. avium ATCC 25291] Length=80 Score = 143 bits (360), Expect = 9e-33, Method: Compositional matrix adjust. Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS VVV AVEHLVRGIVDNPDDVRVD++TSRRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSTVVVHAVEHLVRGIVDNPDDVRVDMVTSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRGIRVDVVDTDQ Sbjct 61 TLVAGIGGRGIRVDVVDTDQ 80 >gi|336459033|gb|EGO37983.1| putative RNA-binding protein (contains KH domain) [Mycobacterium avium subsp. paratuberculosis S397] Length=80 Score = 142 bits (358), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS VVVDAVEHLVRGIVDNPDDVRVD++TSRRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSTVVVDAVEHLVRGIVDNPDDVRVDMVTSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIG RGIRVDVVDTDQ Sbjct 61 TLVAGIGRRGIRVDVVDTDQ 80 >gi|54026127|ref|YP_120369.1| hypothetical protein nfa41560 [Nocardia farcinica IFM 10152] gi|54017635|dbj|BAD59005.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=80 Score = 142 bits (357), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 76/80 (95%), Positives = 77/80 (97%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRV+LIT RRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSAVVADAVEHLVRGIVANPDDVRVELITGRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRGIRVDVVDTDQ Sbjct 61 TLVAGIGGRGIRVDVVDTDQ 80 >gi|226305932|ref|YP_002765892.1| hypothetical protein RER_24450 [Rhodococcus erythropolis PR4] gi|226185049|dbj|BAH33153.1| conserved hypothetical protein [Rhodococcus erythropolis PR4] Length=80 Score = 140 bits (354), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 75/80 (94%), Positives = 77/80 (97%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRV+LIT RRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSAVVADAVEHLVRGIVANPDDVRVELITGRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLV+GIGGRGIRVDVVDTDQ Sbjct 61 TLVSGIGGRGIRVDVVDTDQ 80 >gi|111023495|ref|YP_706467.1| hypothetical protein RHA1_ro06536 [Rhodococcus jostii RHA1] gi|226365997|ref|YP_002783780.1| hypothetical protein ROP_65880 [Rhodococcus opacus B4] gi|110823025|gb|ABG98309.1| conserved hypothetical protein [Rhodococcus jostii RHA1] gi|226244487|dbj|BAH54835.1| hypothetical protein [Rhodococcus opacus B4] Length=80 Score = 139 bits (349), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 74/80 (93%), Positives = 77/80 (97%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRV+LIT RRGRTVEVHV+PDDLGKVIGRGGRTATALR Sbjct 1 MSAVVADAVEHLVRGIVANPDDVRVELITGRRGRTVEVHVNPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLV+GIGGRGIRVDVVDTDQ Sbjct 61 TLVSGIGGRGIRVDVVDTDQ 80 >gi|312139213|ref|YP_004006549.1| RNA binding protein [Rhodococcus equi 103S] gi|325673480|ref|ZP_08153171.1| RNA-binding protein [Rhodococcus equi ATCC 33707] gi|311888552|emb|CBH47864.1| putative RNA binding protein [Rhodococcus equi 103S] gi|325555501|gb|EGD25172.1| RNA-binding protein [Rhodococcus equi ATCC 33707] Length=80 Score = 138 bits (347), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/79 (94%), Positives = 76/79 (97%), Gaps = 0/79 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRV+LIT RRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSAVVADAVEHLVRGIVANPDDVRVELITGRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTD 79 TLV+GIGGRGIRVDVVDTD Sbjct 61 TLVSGIGGRGIRVDVVDTD 79 >gi|118468387|ref|YP_886776.1| hypothetical protein MSMEG_2436 [Mycobacterium smegmatis str. MC2 155] gi|118169674|gb|ABK70570.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2 155] Length=76 Score = 137 bits (346), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 72/76 (95%), Positives = 76/76 (100%), Gaps = 0/76 (0%) Query 5 VVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVA 64 +VDAVEHLVRGIVDNPDDVRVD++T+RRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVA Sbjct 1 MVDAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVA 60 Query 65 GIGGRGIRVDVVDTDQ 80 GIGGRGIRVDVVDTDQ Sbjct 61 GIGGRGIRVDVVDTDQ 76 >gi|333991270|ref|YP_004523884.1| hypothetical protein JDM601_2630 [Mycobacterium sp. JDM601] gi|333487238|gb|AEF36630.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=77 Score = 135 bits (340), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 71/77 (93%), Positives = 76/77 (99%), Gaps = 0/77 (0%) Query 4 VVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLV 63 +V DAVEHLVRGIVDNPDDVRVD++T+RRGRTVEVHVHPDDLGKVIGRGGRTATALRTLV Sbjct 1 MVADAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLV 60 Query 64 AGIGGRGIRVDVVDTDQ 80 AGIGGRGIRVDVVDTD+ Sbjct 61 AGIGGRGIRVDVVDTDR 77 >gi|169630309|ref|YP_001703958.1| hypothetical protein MAB_3228c [Mycobacterium abscessus ATCC 19977] gi|169242276|emb|CAM63304.1| Conserved hypothetical protein [Mycobacterium abscessus] Length=76 Score = 135 bits (339), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 71/76 (94%), Positives = 76/76 (100%), Gaps = 0/76 (0%) Query 5 VVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVA 64 +VDAVEHLVRGIVDNPDDVRVDL+T+RRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVA Sbjct 1 MVDAVEHLVRGIVDNPDDVRVDLVTNRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVA 60 Query 65 GIGGRGIRVDVVDTDQ 80 G+GGRGIRVDVVDTD+ Sbjct 61 GVGGRGIRVDVVDTDR 76 >gi|333919235|ref|YP_004492816.1| hypothetical protein AS9A_1567 [Amycolicicoccus subflavus DQS3-9A1] gi|333481456|gb|AEF40016.1| hypothetical protein AS9A_1567 [Amycolicicoccus subflavus DQS3-9A1] Length=80 Score = 134 bits (338), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 69/80 (87%), Positives = 76/80 (95%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS+V++DAVEHLVRGIV NPDDVRV + T+RRGRT+EVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSSVLIDAVEHLVRGIVSNPDDVRVGMSTTRRGRTIEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLV+GIGGRGIRVDVVDTD Sbjct 61 TLVSGIGGRGIRVDVVDTDN 80 >gi|326382873|ref|ZP_08204563.1| hypothetical protein SCNU_08038 [Gordonia neofelifaecis NRRL B-59395] gi|326198463|gb|EGD55647.1| hypothetical protein SCNU_08038 [Gordonia neofelifaecis NRRL B-59395] Length=80 Score = 134 bits (336), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 71/80 (89%), Positives = 75/80 (94%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRVDLIT RRGR VEVHV+PDDLGKVIGR GRTATALR Sbjct 1 MSAVVADAVEHLVRGIVANPDDVRVDLITGRRGRMVEVHVNPDDLGKVIGRNGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGGRG+RVD+VDTD+ Sbjct 61 TLVAGIGGRGVRVDIVDTDR 80 >gi|296139335|ref|YP_003646578.1| hypothetical protein Tpau_1618 [Tsukamurella paurometabola DSM 20162] gi|296027469|gb|ADG78239.1| conserved hypothetical protein [Tsukamurella paurometabola DSM 20162] Length=82 Score = 132 bits (331), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 69/80 (87%), Positives = 74/80 (93%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRVDLIT RRGR +EVHV+PDDLGKVIGR GRTATALR Sbjct 1 MSAVVADAVEHLVRGIVSNPDDVRVDLITGRRGRVIEVHVNPDDLGKVIGRSGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLV GIGG+GIR+DVVDTD+ Sbjct 61 TLVTGIGGKGIRIDVVDTDR 80 >gi|343925314|ref|ZP_08764839.1| hypothetical protein GOALK_040_00180 [Gordonia alkanivorans NBRC 16433] gi|343764753|dbj|GAA11765.1| hypothetical protein GOALK_040_00180 [Gordonia alkanivorans NBRC 16433] Length=80 Score = 131 bits (330), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 69/80 (87%), Positives = 74/80 (93%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRVDL+T RRGR VEVHV PDDLGKVIGR GRTATALR Sbjct 1 MSAVVADAVEHLVRGIVSNPDDVRVDLVTGRRGRLVEVHVSPDDLGKVIGRNGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLV+GIGGRG+RVD+VDTD+ Sbjct 61 TLVSGIGGRGMRVDIVDTDR 80 >gi|262202021|ref|YP_003273229.1| hypothetical protein Gbro_2084 [Gordonia bronchialis DSM 43247] gi|262085368|gb|ACY21336.1| conserved hypothetical protein [Gordonia bronchialis DSM 43247] Length=80 Score = 130 bits (328), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MSAVV DAVEHLVRGIV NPDDVRVDL+T RRGR VEVHV+P+DLGKVIGR GRTATALR Sbjct 1 MSAVVADAVEHLVRGIVANPDDVRVDLVTGRRGRLVEVHVNPEDLGKVIGRNGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 TLVAGIGG+G+RVD+VDTD+ Sbjct 61 TLVAGIGGKGMRVDIVDTDR 80 >gi|134102489|ref|YP_001108150.1| hypothetical protein SACE_6052 [Saccharopolyspora erythraea NRRL 2338] gi|291004120|ref|ZP_06562093.1| hypothetical protein SeryN2_06342 [Saccharopolyspora erythraea NRRL 2338] gi|133915112|emb|CAM05225.1| hypothetical protein SACE_6052 [Saccharopolyspora erythraea NRRL 2338] Length=79 Score = 128 bits (321), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 65/78 (84%), Positives = 75/78 (97%), Gaps = 0/78 (0%) Query 3 AVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTL 62 V+ DA+EHLVRGIVDNPDDVRV L+T+RRGRT+EVHV+PDDLGKVIGRGGRTATALRT+ Sbjct 2 TVLADALEHLVRGIVDNPDDVRVQLLTTRRGRTLEVHVNPDDLGKVIGRGGRTATALRTV 61 Query 63 VAGIGGRGIRVDVVDTDQ 80 ++GIGGRGIRVDVVDTD+ Sbjct 62 ISGIGGRGIRVDVVDTDR 79 >gi|256379919|ref|YP_003103579.1| hypothetical protein Amir_5925 [Actinosynnema mirum DSM 43827] gi|255924222|gb|ACU39733.1| conserved hypothetical protein [Actinosynnema mirum DSM 43827] Length=79 Score = 125 bits (314), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 62/78 (80%), Positives = 76/78 (98%), Gaps = 0/78 (0%) Query 3 AVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTL 62 +++ DA+EHLVRGIVD+PD+VRV+L+T+RRGRT+EVHVHPDDLGKVIGR GRTATALRT+ Sbjct 2 SLLADALEHLVRGIVDHPDEVRVNLVTTRRGRTLEVHVHPDDLGKVIGRSGRTATALRTV 61 Query 63 VAGIGGRGIRVDVVDTDQ 80 +AGIGGRG+RVDVVDTD+ Sbjct 62 MAGIGGRGVRVDVVDTDR 79 >gi|257055028|ref|YP_003132860.1| hypothetical protein Svir_09760 [Saccharomonospora viridis DSM 43017] gi|256584900|gb|ACU96033.1| predicted RNA-binding protein (contains KH domain) [Saccharomonospora viridis DSM 43017] Length=79 Score = 124 bits (312), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 61/78 (79%), Positives = 74/78 (95%), Gaps = 0/78 (0%) Query 3 AVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTL 62 + + D++EHLVRGIVDNPDDV+V+LIT+RRGRT+EVHVHPDDLGKVIGRGGRTATALRT+ Sbjct 2 SFLADSLEHLVRGIVDNPDDVQVELITTRRGRTLEVHVHPDDLGKVIGRGGRTATALRTV 61 Query 63 VAGIGGRGIRVDVVDTDQ 80 + +GGRG+RVDVVDTD+ Sbjct 62 MGAVGGRGVRVDVVDTDR 79 >gi|15827852|ref|NP_302115.1| hypothetical protein ML1617 [Mycobacterium leprae TN] gi|221230329|ref|YP_002503745.1| hypothetical protein MLBr_01617 [Mycobacterium leprae Br4923] gi|7388545|sp|O33015.1|Y1617_MYCLE RecName: Full=UPF0109 protein ML1617 gi|2251156|emb|CAB10627.1| hypothetical protein MLCB250.30 [Mycobacterium leprae] gi|13093404|emb|CAC30568.1| conserved hypothetical protein [Mycobacterium leprae] gi|219933436|emb|CAR71712.1| conserved hypothetical protein [Mycobacterium leprae Br4923] Length=80 Score = 121 bits (303), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 75/80 (94%), Positives = 77/80 (97%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 MS VVVDAVEH+VRGIVDNPDDVRVDL+ SRRGRTVEVHVHPDDLGKVIGRGGRTATALR Sbjct 1 MSTVVVDAVEHVVRGIVDNPDDVRVDLVISRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 LVAGIGGRGIRVDVVDTDQ Sbjct 61 KLVAGIGGRGIRVDVVDTDQ 80 >gi|284992390|ref|YP_003410944.1| hypothetical protein Gobs_4007 [Geodermatophilus obscurus DSM 43160] gi|284065635|gb|ADB76573.1| conserved hypothetical protein [Geodermatophilus obscurus DSM 43160] Length=78 Score = 112 bits (281), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 55/73 (76%), Positives = 69/73 (95%), Gaps = 0/73 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVD+P+DV VDL+++RRG+T+EV VHPDDLGKVIGRGGRTA ALRT++ G+ Sbjct 4 EALEHLVKGIVDHPEDVTVDLLSNRRGKTLEVRVHPDDLGKVIGRGGRTAKALRTVMTGV 63 Query 67 GGRGIRVDVVDTD 79 GGRG+RVDVVDTD Sbjct 64 GGRGLRVDVVDTD 76 >gi|312194950|ref|YP_004015011.1| hypothetical protein FraEuI1c_1068 [Frankia sp. EuI1c] gi|311226286|gb|ADP79141.1| hypothetical protein FraEuI1c_1068 [Frankia sp. EuI1c] Length=77 Score = 111 bits (278), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 57/73 (79%), Positives = 68/73 (94%), Gaps = 0/73 (0%) Query 8 AVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIG 67 A+EHLVRGIVD+PDDVRVDL ++RRGRT+EV VHP+DLGKVIGR GRTA ALRT++AG+G Sbjct 5 ALEHLVRGIVDHPDDVRVDLQSNRRGRTLEVRVHPEDLGKVIGRRGRTARALRTVMAGVG 64 Query 68 GRGIRVDVVDTDQ 80 GRG+RVDVVD D+ Sbjct 65 GRGLRVDVVDVDR 77 >gi|258653301|ref|YP_003202457.1| KH domain-containing protein [Nakamurella multipartita DSM 44233] gi|258556526|gb|ACV79468.1| KH domain-containing protein [Nakamurella multipartita DSM 44233] Length=77 Score = 111 bits (277), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 57/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 DA+EHLVRGIVD+ DDV V++ T RRGRT+++ VHPDDLGKVIGRGGRTATALRT++ I Sbjct 4 DALEHLVRGIVDHDDDVSVEMTTGRRGRTLQIRVHPDDLGKVIGRGGRTATALRTVMTAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVDVVDTD+ Sbjct 64 GGRGIRVDVVDTDR 77 >gi|296394374|ref|YP_003659258.1| hypothetical protein Srot_1970 [Segniliparus rotundus DSM 44985] gi|296181521|gb|ADG98427.1| conserved hypothetical protein [Segniliparus rotundus DSM 44985] Length=80 Score = 110 bits (275), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 M+ +V+A EHL+RGIV NPDDV V L+ RRGR +EVHVHP+DLGK IGRGGRTA+ALR Sbjct 1 MTDTLVEATEHLIRGIVANPDDVSVRLVAGRRGRVLEVHVHPEDLGKAIGRGGRTASALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 T+V IGGRG+RVD VD D+ Sbjct 61 TVVNSIGGRGVRVDFVDLDR 80 >gi|317508407|ref|ZP_07966077.1| hypothetical protein HMPREF9336_02449 [Segniliparus rugosus ATCC BAA-974] gi|316253254|gb|EFV12654.1| hypothetical protein HMPREF9336_02449 [Segniliparus rugosus ATCC BAA-974] Length=80 Score = 110 bits (275), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 55/80 (69%), Positives = 67/80 (84%), Gaps = 0/80 (0%) Query 1 MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALR 60 M+ +V+A EHL+RGIV NPDDV+V L+ RRGR +EVHVHP+DLGK IGRGGRTA+ALR Sbjct 1 MTDTLVEATEHLIRGIVANPDDVQVRLVGGRRGRVLEVHVHPEDLGKAIGRGGRTASALR 60 Query 61 TLVAGIGGRGIRVDVVDTDQ 80 T+V IGGRG+RVD VD D+ Sbjct 61 TVVNSIGGRGVRVDFVDLDR 80 >gi|158313001|ref|YP_001505509.1| hypothetical protein Franean1_1149 [Frankia sp. EAN1pec] gi|288922433|ref|ZP_06416621.1| conserved hypothetical protein [Frankia sp. EUN1f] gi|158108406|gb|ABW10603.1| conserved hypothetical protein [Frankia sp. EAN1pec] gi|288346236|gb|EFC80577.1| conserved hypothetical protein [Frankia sp. EUN1f] Length=77 Score = 110 bits (275), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 56/73 (77%), Positives = 66/73 (91%), Gaps = 0/73 (0%) Query 8 AVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIG 67 A+EHLVRGIVD PDDVRVDL ++RRGRT+EV VHPDDLGKVIGR GRTA ALRT++ G+G Sbjct 5 ALEHLVRGIVDYPDDVRVDLSSNRRGRTLEVRVHPDDLGKVIGRRGRTARALRTVMGGVG 64 Query 68 GRGIRVDVVDTDQ 80 GRG+R+DVVD D+ Sbjct 65 GRGLRIDVVDVDR 77 >gi|336179499|ref|YP_004584874.1| hypothetical protein FsymDg_3675 [Frankia symbiont of Datisca glomerata] gi|334860479|gb|AEH10953.1| UPF0109 protein [Frankia symbiont of Datisca glomerata] Length=77 Score = 109 bits (273), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 55/73 (76%), Positives = 67/73 (92%), Gaps = 0/73 (0%) Query 8 AVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIG 67 A+EHLVRGIVD+PDDV V+L + RRGRT++V VHPDDLGKVIGRGGRTA ALRT++AG+G Sbjct 5 ALEHLVRGIVDHPDDVHVNLQSGRRGRTLQVRVHPDDLGKVIGRGGRTARALRTVMAGVG 64 Query 68 GRGIRVDVVDTDQ 80 GRG+RVDV+D D+ Sbjct 65 GRGLRVDVIDVDR 77 >gi|300783878|ref|YP_003764169.1| RNA-binding protein [Amycolatopsis mediterranei U32] gi|302525173|ref|ZP_07277515.1| UPF0109 protein [Streptomyces sp. AA4] gi|299793392|gb|ADJ43767.1| predicted RNA-binding protein [Amycolatopsis mediterranei U32] gi|302434068|gb|EFL05884.1| UPF0109 protein [Streptomyces sp. AA4] gi|340525272|gb|AEK40477.1| hypothetical protein RAM_09935 [Amycolatopsis mediterranei S699] Length=79 Score = 107 bits (268), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 62/78 (80%), Positives = 75/78 (97%), Gaps = 0/78 (0%) Query 3 AVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTL 62 + + D++EHLVRGIVDNPD+VRV+L+T+RRGRT+EVHVHPDDLGKVIGRGGRTATALRT+ Sbjct 2 SFLADSLEHLVRGIVDNPDEVRVELLTTRRGRTLEVHVHPDDLGKVIGRGGRTATALRTV 61 Query 63 VAGIGGRGIRVDVVDTDQ 80 + GIGGRG+RVDVVDTD+ Sbjct 62 MGGIGGRGVRVDVVDTDR 79 >gi|86742274|ref|YP_482674.1| hypothetical protein Francci3_3593 [Frankia sp. CcI3] gi|86569136|gb|ABD12945.1| conserved hypothetical protein SC2E1.09 [Frankia sp. CcI3] Length=77 Score = 107 bits (267), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 55/73 (76%), Positives = 65/73 (90%), Gaps = 0/73 (0%) Query 8 AVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIG 67 A+EHLVRGIVD+PDDVRVDL RRGRT+EV VHP+DLGKVIGR GRTA ALRT++ G+G Sbjct 5 ALEHLVRGIVDHPDDVRVDLNNGRRGRTLEVRVHPEDLGKVIGRRGRTARALRTVMGGVG 64 Query 68 GRGIRVDVVDTDQ 80 GRG+R+DVVD D+ Sbjct 65 GRGLRIDVVDVDR 77 >gi|345009609|ref|YP_004811963.1| hypothetical protein Strvi_1948 [Streptomyces violaceusniger Tu 4113] gi|344035958|gb|AEM81683.1| UPF0109 protein [Streptomyces violaceusniger Tu 4113] Length=79 Score = 106 bits (265), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 56/74 (76%), Positives = 63/74 (86%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V T RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRTLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|182435681|ref|YP_001823400.1| hypothetical protein SGR_1888 [Streptomyces griseus subsp. griseus NBRC 13350] gi|239991081|ref|ZP_04711745.1| hypothetical protein SrosN1_27509 [Streptomyces roseosporus NRRL 11379] gi|291448081|ref|ZP_06587471.1| UPF0109 protein [Streptomyces roseosporus NRRL 15998] gi|326776306|ref|ZP_08235571.1| UPF0109 protein [Streptomyces cf. griseus XylebKG-1] gi|178464197|dbj|BAG18717.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] gi|291351028|gb|EFE77932.1| UPF0109 protein [Streptomyces roseosporus NRRL 15998] gi|326656639|gb|EGE41485.1| UPF0109 protein [Streptomyces griseus XylebKG-1] Length=79 Score = 106 bits (265), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 56/74 (76%), Positives = 63/74 (86%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V T RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVAERTLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|254393819|ref|ZP_05008931.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] gi|294815371|ref|ZP_06774014.1| putative RNA-binding protein [Streptomyces clavuligerus ATCC 27064] gi|302542208|ref|ZP_07294550.1| putative RNA-binding protein [Streptomyces hygroscopicus ATCC 53653] gi|326443723|ref|ZP_08218457.1| hypothetical protein SclaA2_21784 [Streptomyces clavuligerus ATCC 27064] gi|197707418|gb|EDY53230.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] gi|294327970|gb|EFG09613.1| putative RNA-binding protein [Streptomyces clavuligerus ATCC 27064] gi|302459826|gb|EFL22919.1| putative RNA-binding protein [Streptomyces himastatinicus ATCC 53653] Length=79 Score = 105 bits (262), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 55/74 (75%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|297191793|ref|ZP_06909191.1| UPF0109 protein [Streptomyces pristinaespiralis ATCC 25486] gi|197721690|gb|EDY65598.1| UPF0109 protein [Streptomyces pristinaespiralis ATCC 25486] gi|328885334|emb|CCA58573.1| KH domain RNA binding protein YlqC [Streptomyces venezuelae ATCC 10712] Length=79 Score = 105 bits (262), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 55/74 (75%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|297156875|gb|ADI06587.1| hypothetical protein SBI_03466 [Streptomyces bingchenggensis BCW-1] Length=79 Score = 104 bits (260), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD DQ Sbjct 64 GGRGVRVDLVDVDQ 77 >gi|331698506|ref|YP_004334745.1| hypothetical protein Psed_4745 [Pseudonocardia dioxanivorans CB1190] gi|326953195|gb|AEA26892.1| UPF0109 protein [Pseudonocardia dioxanivorans CB1190] Length=79 Score = 104 bits (260), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 63/78 (81%), Positives = 75/78 (97%), Gaps = 0/78 (0%) Query 3 AVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTL 62 +V+ DA+EHLVRGIVD+PDDVRVDL+T+RRGRT+EV VHP+DLGKVIGRGGRTATALRT+ Sbjct 2 SVLADALEHLVRGIVDHPDDVRVDLVTNRRGRTLEVRVHPEDLGKVIGRGGRTATALRTV 61 Query 63 VAGIGGRGIRVDVVDTDQ 80 + GIGGRG+RVDVVDTD+ Sbjct 62 MGGIGGRGVRVDVVDTDR 79 >gi|320008294|gb|ADW03144.1| hypothetical protein Sfla_1708 [Streptomyces flavogriseus ATCC 33331] Length=79 Score = 104 bits (259), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 55/74 (75%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRDLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|291454412|ref|ZP_06593802.1| UPF0109 protein [Streptomyces albus J1074] gi|291357361|gb|EFE84263.1| UPF0109 protein [Streptomyces albus J1074] Length=78 Score = 103 bits (258), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA +LRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVAERNLRRGRVLEVRVHPDDLGKVIGRNGRTARSLRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|254382007|ref|ZP_04997369.1| conserved hypothetical protein [Streptomyces sp. Mg1] gi|302537190|ref|ZP_07289532.1| conserved hypothetical protein [Streptomyces sp. C] gi|194340914|gb|EDX21880.1| conserved hypothetical protein [Streptomyces sp. Mg1] gi|302446085|gb|EFL17901.1| conserved hypothetical protein [Streptomyces sp. C] Length=79 Score = 103 bits (258), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRG+ +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGQVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|295836291|ref|ZP_06823224.1| RNA-binding protein [Streptomyces sp. SPB74] gi|197697344|gb|EDY44277.1| RNA-binding protein [Streptomyces sp. SPB74] Length=79 Score = 103 bits (258), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 55/74 (75%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V T RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVAERTLRRGRVLEVRVHPDDLGKVIGRSGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD D Sbjct 64 GGRGIRVDLVDVDH 77 >gi|297202647|ref|ZP_06920044.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|197713222|gb|EDY57256.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length=79 Score = 103 bits (257), Expect = 8e-21, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V T RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRTLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD D Sbjct 64 GGRGVRVDLVDVDH 77 >gi|345002323|ref|YP_004805177.1| hypothetical protein SACTE_4811 [Streptomyces sp. SirexAA-E] gi|344317949|gb|AEN12637.1| conserved hypothetical protein [Streptomyces sp. SirexAA-E] Length=79 Score = 103 bits (256), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHP+DLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRDLRRGRVLEVRVHPEDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD DQ Sbjct 64 GGRGIRVDLVDVDQ 77 >gi|302522158|ref|ZP_07274500.1| conserved hypothetical protein [Streptomyces sp. SPB78] gi|318056565|ref|ZP_07975288.1| hypothetical protein SSA3_01397 [Streptomyces sp. SA3_actG] gi|318077469|ref|ZP_07984801.1| hypothetical protein SSA3_12327 [Streptomyces sp. SA3_actF] gi|302431053|gb|EFL02869.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length=79 Score = 103 bits (256), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V T RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVAERTLRRGRVLEVRVHPDDLGKVIGRSGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD D Sbjct 64 GGRGVRVDLVDVDH 77 >gi|302558142|ref|ZP_07310484.1| RNA-binding protein [Streptomyces griseoflavus Tu4000] gi|302475760|gb|EFL38853.1| RNA-binding protein [Streptomyces griseoflavus Tu4000] Length=79 Score = 102 bits (255), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 54/74 (73%), Positives = 61/74 (83%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRGIRVD+VD D Sbjct 64 GGRGIRVDLVDVDH 77 >gi|145593857|ref|YP_001158154.1| hypothetical protein Strop_1306 [Salinispora tropica CNB-440] gi|145303194|gb|ABP53776.1| hypothetical protein Strop_1306 [Salinispora tropica CNB-440] Length=86 Score = 102 bits (254), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 50/71 (71%), Positives = 61/71 (86%), Gaps = 0/71 (0%) Query 8 AVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIG 67 A+EHLV+GIVDNPDDVRV L+ SRRG+ +EV VHP+DLG VIGR GRTA ALR ++ IG Sbjct 15 ALEHLVKGIVDNPDDVRVRLVDSRRGKRLEVRVHPEDLGTVIGRSGRTAKALRQVIGSIG 74 Query 68 GRGIRVDVVDT 78 GRG+RVD+VD+ Sbjct 75 GRGVRVDIVDS 85 >gi|21223947|ref|NP_629726.1| hypothetical protein SCO5592 [Streptomyces coelicolor A3(2)] gi|289768843|ref|ZP_06528221.1| UPF0109 protein [Streptomyces lividans TK24] gi|291437012|ref|ZP_06576402.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] 10 more sequence titles Length=79 Score = 102 bits (253), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 53/74 (72%), Positives = 61/74 (83%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD D Sbjct 64 GGRGVRVDLVDVDH 77 >gi|337768417|emb|CCB77130.1| conserved protein of unknown function [Streptomyces cattleya NRRL 8057] Length=79 Score = 102 bits (253), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 52/74 (71%), Positives = 63/74 (86%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIV++PDDV+V T RRGR +EV VHPDDLGKVIGR GRTA ALRT+V + Sbjct 4 EALEHLVKGIVEHPDDVQVASRTLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAL 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD DQ Sbjct 64 GGRGVRVDLVDVDQ 77 >gi|294631645|ref|ZP_06710205.1| RNA-binding protein [Streptomyces sp. e14] gi|292834978|gb|EFF93327.1| RNA-binding protein [Streptomyces sp. e14] Length=79 Score = 101 bits (251), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 52/74 (71%), Positives = 61/74 (83%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHP+DLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPEDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD D Sbjct 64 GGRGVRVDLVDVDH 77 >gi|29829185|ref|NP_823819.1| hypothetical protein SAV_2643 [Streptomyces avermitilis MA-4680] gi|29606291|dbj|BAC70354.1| hypothetical protein [Streptomyces avermitilis MA-4680] Length=79 Score = 100 bits (250), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 53/74 (72%), Positives = 61/74 (83%), Gaps = 0/74 (0%) Query 7 DAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGI 66 +A+EHLV+GIVDNPDDV+V RRGR +EV VHPDDLGKVIGR GRTA ALRT+V I Sbjct 4 EALEHLVKGIVDNPDDVQVASRDLRRGRVLEVRVHPDDLGKVIGRNGRTARALRTVVGAI 63 Query 67 GGRGIRVDVVDTDQ 80 GGRG+RVD+VD D Sbjct 64 GGRGVRVDLVDVDH 77 Lambda K H 0.321 0.142 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 128850890930 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40