BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv2960c Length=82 Score E Sequences producing significant alignments: (Bits) Value gi|15842511|ref|NP_337548.1| hypothetical protein MT3036 [Mycoba... 166 1e-39 gi|15610097|ref|NP_217476.1| hypothetical protein Rv2960c [Mycob... 163 6e-39 gi|213649341|ref|ZP_03379394.1| hypothetical protein SentesTy_19... 66.6 1e-09 >gi|15842511|ref|NP_337548.1| hypothetical protein MT3036 [Mycobacterium tuberculosis CDC1551] gi|167970021|ref|ZP_02552298.1| hypothetical protein MtubH3_19118 [Mycobacterium tuberculosis H37Ra] gi|13882820|gb|AAK47362.1| hypothetical protein MT3036 [Mycobacterium tuberculosis CDC1551] Length=116 Score = 166 bits (419), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 82/82 (100%), Positives = 82/82 (100%), Gaps = 0/82 (0%) Query 1 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRGLRVTPICCYHPPCGGGVQKMLSRKLGR 60 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRGLRVTPICCYHPPCGGGVQKMLSRKLGR Sbjct 35 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRGLRVTPICCYHPPCGGGVQKMLSRKLGR 94 Query 61 VCPAPSPKDAARGAHNVGANAV 82 VCPAPSPKDAARGAHNVGANAV Sbjct 95 VCPAPSPKDAARGAHNVGANAV 116 >gi|15610097|ref|NP_217476.1| hypothetical protein Rv2960c [Mycobacterium tuberculosis H37Rv] gi|31794136|ref|NP_856629.1| hypothetical protein Mb2984c [Mycobacterium bovis AF2122/97] gi|121638841|ref|YP_979065.1| hypothetical protein BCG_2981c [Mycobacterium bovis BCG str. Pasteur 1173P2] 46 more sequence titlesLength=82 Score = 163 bits (413), Expect = 6e-39, Method: Compositional matrix adjust. Identities = 81/82 (99%), Positives = 82/82 (100%), Gaps = 0/82 (0%) Query 1 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRGLRVTPICCYHPPCGGGVQKMLSRKLGR 60 +GRNATAVVSLPVVALSPRAGQAGYLWQSITRGLRVTPICCYHPPCGGGVQKMLSRKLGR Sbjct 1 MGRNATAVVSLPVVALSPRAGQAGYLWQSITRGLRVTPICCYHPPCGGGVQKMLSRKLGR 60 Query 61 VCPAPSPKDAARGAHNVGANAV 82 VCPAPSPKDAARGAHNVGANAV Sbjct 61 VCPAPSPKDAARGAHNVGANAV 82 >gi|213649341|ref|ZP_03379394.1| hypothetical protein SentesTy_19872 [Salmonella enterica subsp. enterica serovar Typhi str. J185] Length=49 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%) Query 1 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRG 33 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRG Sbjct 17 VGRNATAVVSLPVVALSPRAGQAGYLWQSITRG 49 Lambda K H 0.321 0.136 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 127967590486 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40