BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv3126c Length=104 Score E Sequences producing significant alignments: (Bits) Value gi|15610263|ref|NP_217642.1| hypothetical protein Rv3126c [Mycob... 209 7e-53 gi|167970207|ref|ZP_02552484.1| hypothetical protein MtubH3_2015... 182 1e-44 gi|340628103|ref|YP_004746555.1| hypothetical protein MCAN_31401... 170 8e-41 gi|294995489|ref|ZP_06801180.1| hypothetical protein Mtub2_13497... 147 7e-34 gi|240173082|ref|ZP_04751740.1| hypothetical protein MkanA1_2746... 43.1 0.014 gi|118617874|ref|YP_906206.1| hypothetical protein MUL_2371 [Myc... 42.7 0.018 gi|183983120|ref|YP_001851411.1| hypothetical protein MMAR_3121 ... 42.7 0.018 gi|240170495|ref|ZP_04749154.1| hypothetical protein MkanA1_1437... 37.7 0.63 gi|240173499|ref|ZP_04752157.1| hypothetical protein MkanA1_2958... 36.2 1.5 gi|240171712|ref|ZP_04750371.1| hypothetical protein MkanA1_2053... 36.2 1.7 gi|108742011|gb|AAI17592.1| Calcoco1 protein [Danio rerio] 35.8 1.9 gi|340625131|ref|YP_004743583.1| hypothetical protein MCAN_00981... 35.8 2.2 gi|63100596|gb|AAH95162.1| Calcoco1 protein [Danio rerio] 35.8 2.2 gi|118617907|ref|YP_906239.1| hypothetical protein MUL_2416 [Myc... 35.4 2.6 gi|240168755|ref|ZP_04747414.1| hypothetical protein MkanA1_0554... 35.4 3.0 gi|253799373|ref|YP_003032374.1| 13E12 repeat family protein [My... 35.0 3.4 gi|340626594|ref|YP_004745046.1| hypothetical protein MCAN_15961... 35.0 3.5 gi|15608726|ref|NP_216104.1| REP13E12 repeat-containing protein ... 35.0 3.5 gi|306775774|ref|ZP_07414111.1| 13E12 repeat family protein [Myc... 35.0 3.5 gi|183981538|ref|YP_001849829.1| hypothetical protein MMAR_1523 ... 35.0 3.6 gi|158749594|ref|NP_001103636.1| calcium-binding and coiled-coil... 35.0 3.6 gi|31791273|ref|NP_853766.1| hypothetical protein Mb0098c [Mycob... 35.0 3.7 gi|289760194|ref|ZP_06519572.1| conserved hypothetical protein [... 35.0 3.7 gi|307084168|ref|ZP_07493281.1| 13E12 repeat family protein [Myc... 35.0 4.0 gi|306971881|ref|ZP_07484542.1| 13E12 repeat family protein [Myc... 34.7 4.3 gi|289445625|ref|ZP_06435369.1| LOW QUALITY PROTEIN: conserved h... 34.7 4.3 gi|307079597|ref|ZP_07488767.1| 13E12 repeat family protein [Myc... 34.7 4.4 gi|289747862|ref|ZP_06507240.1| LOW QUALITY PROTEIN: conserved h... 34.7 4.5 gi|15841040|ref|NP_336077.1| hypothetical protein MT1623 [Mycoba... 34.7 4.5 gi|289757690|ref|ZP_06517068.1| conserved hypothetical protein [... 34.7 4.6 gi|289443040|ref|ZP_06432784.1| 13E12 repeat family protein [Myc... 34.7 4.6 gi|289753674|ref|ZP_06513052.1| conserved hypothetical protein [... 34.7 4.6 gi|289572675|ref|ZP_06452902.1| LOW QUALITY PROTEIN: conserved h... 34.7 4.7 gi|331243223|ref|XP_003334255.1| coiled coil AKL27 [Puccinia gra... 34.7 5.0 gi|254552570|ref|ZP_05143017.1| hypothetical protein Mtube_19340... 34.7 5.0 gi|289755599|ref|ZP_06514977.1| conserved hypothetical protein [... 34.7 5.4 gi|253800511|ref|YP_003033512.1| hypothetical protein TBMG_03514... 34.3 5.8 gi|307086247|ref|ZP_07495360.1| hypothetical protein TMLG_03055 ... 34.3 6.0 gi|340628249|ref|YP_004746701.1| hypothetical protein MCAN_32901... 34.3 6.1 gi|289445066|ref|ZP_06434810.1| conserved hypothetical protein [... 34.3 6.2 gi|15610602|ref|NP_217983.1| hypothetical protein Rv3466 [Mycoba... 34.3 6.3 gi|308380706|ref|ZP_07490811.2| hypothetical protein TMKG_03818 ... 34.3 6.7 gi|308379520|ref|ZP_07486593.2| hypothetical protein TMJG_03661 ... 34.3 6.9 gi|254818822|ref|ZP_05223823.1| hypothetical protein MintA_02799... 34.3 7.0 gi|340628437|ref|YP_004746889.1| hypothetical protein MCAN_34831... 33.9 7.3 gi|308232470|ref|ZP_07416151.2| rep13E12 repeat protein [Mycobac... 33.9 7.3 gi|167966767|ref|ZP_02549044.1| hypothetical protein MtubH3_0134... 33.9 7.3 gi|306790720|ref|ZP_07429042.1| hypothetical protein TMDG_03210 ... 33.9 7.5 gi|118463582|ref|YP_882158.1| REPhypothetical protein [Mycobacte... 33.9 7.7 gi|31794642|ref|NP_857135.1| hypothetical protein Mb3495 [Mycoba... 33.9 7.8 >gi|15610263|ref|NP_217642.1| hypothetical protein Rv3126c [Mycobacterium tuberculosis H37Rv] gi|15842700|ref|NP_337737.1| hypothetical protein MT3211 [Mycobacterium tuberculosis CDC1551] gi|31794301|ref|NP_856794.1| hypothetical protein Mb3149c [Mycobacterium bovis AF2122/97] 50 more sequence titles Length=104 Score = 209 bits (533), Expect = 7e-53, Method: Compositional matrix adjust. Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%) Query 1 MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER 60 MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER Sbjct 1 MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER 60 Query 61 DRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQWPKAVWAVIDNP 104 DRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQWPKAVWAVIDNP Sbjct 61 DRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQWPKAVWAVIDNP 104 >gi|167970207|ref|ZP_02552484.1| hypothetical protein MtubH3_20153 [Mycobacterium tuberculosis H37Ra] gi|313660096|ref|ZP_07816976.1| hypothetical protein MtubKV_16822 [Mycobacterium tuberculosis KZN V2475] Length=90 Score = 182 bits (462), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 90/90 (100%), Positives = 90/90 (100%), Gaps = 0/90 (0%) Query 15 MKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSR 74 MKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSR Sbjct 1 MKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSR 60 Query 75 SRSQLSPRMAHGAVHQCQWPKAVWAVIDNP 104 SRSQLSPRMAHGAVHQCQWPKAVWAVIDNP Sbjct 61 SRSQLSPRMAHGAVHQCQWPKAVWAVIDNP 90 >gi|340628103|ref|YP_004746555.1| hypothetical protein MCAN_31401 [Mycobacterium canettii CIPT 140010059] gi|340006293|emb|CCC45471.1| hypothetical protein MCAN_31401 [Mycobacterium canettii CIPT 140010059] Length=86 Score = 170 bits (430), Expect = 8e-41, Method: Compositional matrix adjust. Identities = 86/86 (100%), Positives = 86/86 (100%), Gaps = 0/86 (0%) Query 1 MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER 60 MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER Sbjct 1 MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER 60 Query 61 DRARRDRDHHPWSRSRSQLSPRMAHG 86 DRARRDRDHHPWSRSRSQLSPRMAHG Sbjct 61 DRARRDRDHHPWSRSRSQLSPRMAHG 86 >gi|294995489|ref|ZP_06801180.1| hypothetical protein Mtub2_13497 [Mycobacterium tuberculosis 210] gi|297635766|ref|ZP_06953546.1| hypothetical protein MtubK4_16662 [Mycobacterium tuberculosis KZN 4207] Length=72 Score = 147 bits (370), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 71/72 (99%), Positives = 72/72 (100%), Gaps = 0/72 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQ 92 +VAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQ Sbjct 1 MVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQ 60 Query 93 WPKAVWAVIDNP 104 WPKAVWAVIDNP Sbjct 61 WPKAVWAVIDNP 72 >gi|240173082|ref|ZP_04751740.1| hypothetical protein MkanA1_27466 [Mycobacterium kansasii ATCC 12478] Length=320 Score = 43.1 bits (100), Expect = 0.014, Method: Compositional matrix adjust. Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%) Query 29 ENSSLVAALDRLDAAVDELSALSFDALTTPERDR 62 + S+VA LDRLDA VD L SFDALTTPER R Sbjct 4 DRESVVAVLDRLDADVDALIETSFDALTTPERLR 37 >gi|118617874|ref|YP_906206.1| hypothetical protein MUL_2371 [Mycobacterium ulcerans Agy99] gi|118569984|gb|ABL04735.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] Length=462 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 22/34 (65%), Positives = 26/34 (77%), Gaps = 0/34 (0%) Query 29 ENSSLVAALDRLDAAVDELSALSFDALTTPERDR 62 + S+VA LDRLD AVD L +SF+ALTTPER R Sbjct 8 DRESVVATLDRLDRAVDALVEVSFEALTTPERLR 41 >gi|183983120|ref|YP_001851411.1| hypothetical protein MMAR_3121 [Mycobacterium marinum M] gi|183176446|gb|ACC41556.1| conserved hypothetical protein [Mycobacterium marinum M] Length=462 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 22/34 (65%), Positives = 26/34 (77%), Gaps = 0/34 (0%) Query 29 ENSSLVAALDRLDAAVDELSALSFDALTTPERDR 62 + S+VA LDRLD AVD L +SF+ALTTPER R Sbjct 8 DRESVVATLDRLDRAVDALVEVSFEALTTPERLR 41 >gi|240170495|ref|ZP_04749154.1| hypothetical protein MkanA1_14375 [Mycobacterium kansasii ATCC 12478] Length=616 Score = 37.7 bits (86), Expect = 0.63, Method: Compositional matrix adjust. Identities = 19/29 (66%), Positives = 21/29 (73%), Gaps = 0/29 (0%) Query 32 SLVAALDRLDAAVDELSALSFDALTTPER 60 S+VA+ D L AV L LSFDALTTPER Sbjct 7 SVVASFDALQLAVSRLQELSFDALTTPER 35 >gi|240173499|ref|ZP_04752157.1| hypothetical protein MkanA1_29581 [Mycobacterium kansasii ATCC 12478] Length=168 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 18/31 (59%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V + LDA +D L LSFD LTTPER RA Sbjct 9 IVGVFNTLDADLDRLCELSFDVLTTPERMRA 39 >gi|240171712|ref|ZP_04750371.1| hypothetical protein MkanA1_20530 [Mycobacterium kansasii ATCC 12478] Length=320 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/28 (65%), Positives = 20/28 (72%), Gaps = 0/28 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPER 60 +VAA D L A + L LSFDALTTPER Sbjct 9 VVAAFDALQATLSRLQELSFDALTTPER 36 >gi|108742011|gb|AAI17592.1| Calcoco1 protein [Danio rerio] Length=241 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 21/73 (29%), Positives = 33/73 (46%), Gaps = 14/73 (19%) Query 11 LVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHH 70 LV+ L Q CL+E + L+ AL+ D V ER++ RR+RD Sbjct 137 LVIPRAQLLQSRLQECLKERAELLQALEAADQNV--------------EREKGRRERDRG 182 Query 71 PWSRSRSQLSPRM 83 W +R +L ++ Sbjct 183 SWEHTRKELERKI 195 >gi|340625131|ref|YP_004743583.1| hypothetical protein MCAN_00981 [Mycobacterium canettii CIPT 140010059] gi|340003321|emb|CCC42439.1| putative uncharacterized protein [Mycobacterium canettii CIPT 140010059] Length=492 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 22/53 (42%), Positives = 28/53 (53%), Gaps = 3/53 (5%) Query 8 IGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER 60 IG+L +S + S E LV D LDA +D L +SF+ LTTPER Sbjct 26 IGALFVSARRYDSNMLANSREE---LVEVFDALDAELDRLDEVSFEVLTTPER 75 >gi|63100596|gb|AAH95162.1| Calcoco1 protein [Danio rerio] Length=209 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 21/73 (29%), Positives = 33/73 (46%), Gaps = 14/73 (19%) Query 11 LVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHH 70 LV+ L Q CL+E + L+ AL+ D V ER++ RR+RD Sbjct 137 LVIPRAQLLQSRLQECLKERAELLQALEAADQNV--------------EREKGRRERDRG 182 Query 71 PWSRSRSQLSPRM 83 W +R +L ++ Sbjct 183 SWEHTRKELERKI 195 >gi|118617907|ref|YP_906239.1| hypothetical protein MUL_2416 [Mycobacterium ulcerans Agy99] gi|118570017|gb|ABL04768.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] Length=534 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPER 60 +VAA D LDA + L L FD LTTPER Sbjct 9 VVAAFDALDAVMTRLQDLCFDGLTTPER 36 >gi|240168755|ref|ZP_04747414.1| hypothetical protein MkanA1_05540 [Mycobacterium kansasii ATCC 12478] Length=62 Score = 35.4 bits (80), Expect = 3.0, Method: Compositional matrix adjust. Identities = 18/35 (52%), Positives = 24/35 (69%), Gaps = 0/35 (0%) Query 25 RCLRENSSLVAALDRLDAAVDELSALSFDALTTPE 59 R + + ++ A D +DAA+D L LSFDALTTPE Sbjct 7 RGVVDPETVTAVFDAVDAALDVLVDLSFDALTTPE 41 >gi|253799373|ref|YP_003032374.1| 13E12 repeat family protein [Mycobacterium tuberculosis KZN 1435] gi|253320876|gb|ACT25479.1| 13E12 repeat family protein [Mycobacterium tuberculosis KZN 1435] gi|328459123|gb|AEB04546.1| 13E12 repeat family protein [Mycobacterium tuberculosis KZN 4207] Length=222 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|340626594|ref|YP_004745046.1| hypothetical protein MCAN_15961 [Mycobacterium canettii CIPT 140010059] gi|340004784|emb|CCC43928.1| partial REP13E12 repeat protein [Mycobacterium canettii CIPT 140010059] Length=164 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|15608726|ref|NP_216104.1| REP13E12 repeat-containing protein [Mycobacterium tuberculosis H37Rv] gi|148661383|ref|YP_001282906.1| REP13E12 repeat-containing protein [Mycobacterium tuberculosis H37Ra] gi|2117249|emb|CAB09081.1| Partial REP13E12 repeat protein [Mycobacterium tuberculosis H37Rv] gi|148505535|gb|ABQ73344.1| REP13E12 repeat protein [Mycobacterium tuberculosis H37Ra] Length=222 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|306775774|ref|ZP_07414111.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu001] gi|308215689|gb|EFO75088.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu001] Length=163 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|183981538|ref|YP_001849829.1| hypothetical protein MMAR_1523 [Mycobacterium marinum M] gi|183174864|gb|ACC39974.1| conserved hypothetical protein [Mycobacterium marinum M] Length=457 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 17/30 (57%), Positives = 19/30 (64%), Gaps = 0/30 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPER 60 +VAA D LDA + L L FD LTTPER Sbjct 7 EEVVAAFDALDAVMARLQDLCFDGLTTPER 36 >gi|158749594|ref|NP_001103636.1| calcium-binding and coiled-coil domain-containing protein 1 [Danio rerio] gi|160016577|sp|A2BGD5.1|CACO1_DANRE RecName: Full=Calcium-binding and coiled-coil domain-containing protein 1 gi|122891067|emb|CAM14487.1| novel protein [Danio rerio] Length=640 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 21/73 (29%), Positives = 33/73 (46%), Gaps = 14/73 (19%) Query 11 LVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHH 70 LV+ L Q CL+E + L+ AL+ D V ER++ RR+RD Sbjct 137 LVIPRAQLLQSRLQECLKERAELLQALEAADQNV--------------EREKGRRERDRG 182 Query 71 PWSRSRSQLSPRM 83 W +R +L ++ Sbjct 183 SWEHTRKELERKI 195 >gi|31791273|ref|NP_853766.1| hypothetical protein Mb0098c [Mycobacterium bovis AF2122/97] gi|121636008|ref|YP_976231.1| hypothetical protein BCG_0128c [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224988481|ref|YP_002643168.1| hypothetical protein JTY_0099 [Mycobacterium bovis BCG str. Tokyo 172] gi|31616858|emb|CAD92960.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] gi|121491655|emb|CAL70113.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224771594|dbj|BAH24400.1| hypothetical protein JTY_0099 [Mycobacterium bovis BCG str. Tokyo 172] gi|341600024|emb|CCC62692.1| conserved hypothetical protein [Mycobacterium bovis BCG str. Moreau RDJ] Length=260 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 47 LVEVFDALDAELDRLDEVSFEVLTTPERLRS 77 >gi|289760194|ref|ZP_06519572.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|289715758|gb|EFD79770.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] Length=260 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 47 LVEVFDALDAELDRLDEVSFEVLTTPERLRS 77 >gi|307084168|ref|ZP_07493281.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu012] gi|308366178|gb|EFP55029.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu012] Length=101 Score = 35.0 bits (79), Expect = 4.0, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|306971881|ref|ZP_07484542.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu010] gi|308358568|gb|EFP47419.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu010] Length=110 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289445625|ref|ZP_06435369.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A] gi|289418583|gb|EFD15784.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A] Length=136 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 47 LVEVFDALDAELDRLDEVSFEVLTTPERLRS 77 >gi|307079597|ref|ZP_07488767.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu011] gi|308362494|gb|EFP51345.1| 13E12 repeat family protein [Mycobacterium tuberculosis SUMu011] Length=130 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289747862|ref|ZP_06507240.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] gi|289688390|gb|EFD55878.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] Length=136 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 47 LVEVFDALDAELDRLDEVSFEVLTTPERLRS 77 >gi|15841040|ref|NP_336077.1| hypothetical protein MT1623 [Mycobacterium tuberculosis CDC1551] gi|31792774|ref|NP_855267.1| REP13E12 repeat-containing protein [Mycobacterium bovis AF2122/97] gi|121637495|ref|YP_977718.1| REP13E12 repeat-containing protein [Mycobacterium bovis BCG str. Pasteur 1173P2] 20 more sequence titles Length=222 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289757690|ref|ZP_06517068.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|289713254|gb|EFD77266.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|344219408|gb|AEN00039.1| REP13E12 repeat-containing protein [Mycobacterium tuberculosis CTRI-2] Length=222 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289443040|ref|ZP_06432784.1| 13E12 repeat family protein [Mycobacterium tuberculosis T46] gi|289569627|ref|ZP_06449854.1| 13E12 repeat family protein [Mycobacterium tuberculosis T17] gi|289751287|ref|ZP_06510665.1| 13E12 repeat family protein [Mycobacterium tuberculosis T92] gi|289415959|gb|EFD13199.1| 13E12 repeat family protein [Mycobacterium tuberculosis T46] gi|289543381|gb|EFD47029.1| 13E12 repeat family protein [Mycobacterium tuberculosis T17] gi|289691874|gb|EFD59303.1| 13E12 repeat family protein [Mycobacterium tuberculosis T92] Length=222 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289753674|ref|ZP_06513052.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] gi|289694261|gb|EFD61690.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] Length=222 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 7 EELVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289572675|ref|ZP_06452902.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|289537106|gb|EFD41684.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Mycobacterium tuberculosis K85] Length=136 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 LV D LDA +D L +SF+ LTTPER R+ Sbjct 47 LVEVFDALDAELDRLDEVSFEVLTTPERLRS 77 >gi|331243223|ref|XP_003334255.1| coiled coil AKL27 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309313245|gb|EFP89836.1| coiled coil AKL27 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length=691 Score = 34.7 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 22/67 (33%), Positives = 31/67 (47%), Gaps = 1/67 (1%) Query 28 RENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSRS-RSQLSPRMAHG 86 RENS + + L A+ +L LS+D TPE R D W+ RSQL P + Sbjct 317 RENSPDIVSPPWLAPAILDLKDLSWDRFGTPEHSSTFRGHDDTGWANGLRSQLDPDGLYI 376 Query 87 AVHQCQW 93 + C + Sbjct 377 TLRICSY 383 >gi|254552570|ref|ZP_05143017.1| hypothetical protein Mtube_19340 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] Length=79 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|289755599|ref|ZP_06514977.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] gi|289696186|gb|EFD63615.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] Length=64 Score = 34.7 bits (78), Expect = 5.4, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 17 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 47 >gi|253800511|ref|YP_003033512.1| hypothetical protein TBMG_03514 [Mycobacterium tuberculosis KZN 1435] gi|253322014|gb|ACT26617.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 1435] Length=222 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|307086247|ref|ZP_07495360.1| hypothetical protein TMLG_03055 [Mycobacterium tuberculosis SUMu012] gi|308364328|gb|EFP53179.1| hypothetical protein TMLG_03055 [Mycobacterium tuberculosis SUMu012] Length=150 Score = 34.3 bits (77), Expect = 6.0, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|340628249|ref|YP_004746701.1| hypothetical protein MCAN_32901 [Mycobacterium canettii CIPT 140010059] gi|340006439|emb|CCC45621.1| putative uncharacterized protein [Mycobacterium canettii CIPT 140010059] Length=453 Score = 34.3 bits (77), Expect = 6.1, Method: Compositional matrix adjust. Identities = 16/30 (54%), Positives = 20/30 (67%), Gaps = 0/30 (0%) Query 31 SSLVAALDRLDAAVDELSALSFDALTTPER 60 LV A D LDA +D L +SF+ LT+PER Sbjct 7 EELVEAFDALDAELDRLDEVSFEVLTSPER 36 >gi|289445066|ref|ZP_06434810.1| conserved hypothetical protein [Mycobacterium tuberculosis T46] gi|289752190|ref|ZP_06511568.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289417985|gb|EFD15225.1| conserved hypothetical protein [Mycobacterium tuberculosis T46] gi|289692777|gb|EFD60206.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] Length=222 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|15610602|ref|NP_217983.1| hypothetical protein Rv3466 [Mycobacterium tuberculosis H37Rv] gi|148824676|ref|YP_001289430.1| hypothetical protein TBFG_13503 [Mycobacterium tuberculosis F11] gi|289576202|ref|ZP_06456429.1| conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|18201946|sp|O06331.1|Y3466_MYCTU RecName: Full=Uncharacterized protein Rv3466/MT3572 gi|2104389|emb|CAB08732.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] gi|148723203|gb|ABR07828.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] gi|289540633|gb|EFD45211.1| conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|328460242|gb|AEB05665.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 4207] Length=222 Score = 34.3 bits (77), Expect = 6.3, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|308380706|ref|ZP_07490811.2| hypothetical protein TMKG_03818 [Mycobacterium tuberculosis SUMu011] gi|308360713|gb|EFP49564.1| hypothetical protein TMKG_03818 [Mycobacterium tuberculosis SUMu011] Length=147 Score = 34.3 bits (77), Expect = 6.7, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 17 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 47 >gi|308379520|ref|ZP_07486593.2| hypothetical protein TMJG_03661 [Mycobacterium tuberculosis SUMu010] gi|308356768|gb|EFP45619.1| hypothetical protein TMJG_03661 [Mycobacterium tuberculosis SUMu010] Length=223 Score = 34.3 bits (77), Expect = 6.9, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 61 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 91 >gi|254818822|ref|ZP_05223823.1| hypothetical protein MintA_02799 [Mycobacterium intracellulare ATCC 13950] Length=454 Score = 34.3 bits (77), Expect = 7.0, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%) Query 32 SLVAALDRLDAAVDELSALSFDALTTPERDR 62 +V D +DA +D L ALSF+ TTPER R Sbjct 8 EIVEVFDAIDADLDRLCALSFEVFTTPERLR 38 >gi|340628437|ref|YP_004746889.1| hypothetical protein MCAN_34831 [Mycobacterium canettii CIPT 140010059] gi|340006627|emb|CCC45814.1| putative uncharacterized protein [Mycobacterium canettii CIPT 140010059] Length=453 Score = 33.9 bits (76), Expect = 7.3, Method: Compositional matrix adjust. Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPER 60 +V D LDA +D L +SFD L+TPER Sbjct 9 IVEVFDALDAELDRLGEVSFDVLSTPER 36 >gi|308232470|ref|ZP_07416151.2| rep13E12 repeat protein [Mycobacterium tuberculosis SUMu001] gi|308213898|gb|EFO73297.1| rep13E12 repeat protein [Mycobacterium tuberculosis SUMu001] Length=225 Score = 33.9 bits (76), Expect = 7.3, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 44 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 74 >gi|167966767|ref|ZP_02549044.1| hypothetical protein MtubH3_01348 [Mycobacterium tuberculosis H37Ra] Length=107 Score = 33.9 bits (76), Expect = 7.3, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|306790720|ref|ZP_07429042.1| hypothetical protein TMDG_03210 [Mycobacterium tuberculosis SUMu004] gi|308332911|gb|EFP21762.1| hypothetical protein TMDG_03210 [Mycobacterium tuberculosis SUMu004] Length=98 Score = 33.9 bits (76), Expect = 7.5, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 >gi|118463582|ref|YP_882158.1| REPhypothetical protein [Mycobacterium avium 104] gi|118164869|gb|ABK65766.1| REP13E12 repeat protein [Mycobacterium avium 104] Length=143 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 17/27 (63%), Positives = 19/27 (71%), Gaps = 0/27 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPE 59 +V D LDAA+D L LSFDALTT E Sbjct 9 IVKVFDALDAALDRLGELSFDALTTRE 35 >gi|31794642|ref|NP_857135.1| hypothetical protein Mb3495 [Mycobacterium bovis AF2122/97] gi|121639386|ref|YP_979610.1| hypothetical protein BCG_3531 [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224991882|ref|YP_002646571.1| hypothetical protein JTY_3531 [Mycobacterium bovis BCG str. Tokyo 172] gi|31620239|emb|CAD95682.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] gi|121495034|emb|CAL73520.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224774997|dbj|BAH27803.1| hypothetical protein JTY_3531 [Mycobacterium bovis BCG str. Tokyo 172] gi|341603407|emb|CCC66088.1| conserved hypothetical protein [Mycobacterium bovis BCG str. Moreau RDJ] Length=222 Score = 33.9 bits (76), Expect = 7.8, Method: Compositional matrix adjust. Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 33 LVAALDRLDAAVDELSALSFDALTTPERDRA 63 +V D LDA +D L +SF+ LTTPER R+ Sbjct 9 IVEVFDALDAELDRLDEVSFEVLTTPERLRS 39 Lambda K H 0.322 0.130 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 127350764394 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40