BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv3224A Length=62 Score E Sequences producing significant alignments: (Bits) Value gi|31794404|ref|NP_856897.1| hypothetical protein Mb3252 [Mycoba... 121 3e-26 gi|148824425|ref|YP_001289179.1| hypothetical protein TBFG_13252... 119 2e-25 gi|340628204|ref|YP_004746656.1| hypothetical protein MCAN_32431... 41.2 0.054 gi|254819141|ref|ZP_05224142.1| hypothetical protein MintA_04404... 39.7 0.15 gi|5305776|gb|AAD41809.1|AF144091_3 unknown [Mycobacterium smegm... 36.6 1.4 gi|118470403|ref|YP_886279.1| YbaK/ebsC protein [Mycobacterium s... 36.6 1.4 gi|326381836|ref|ZP_08203529.1| hypothetical protein SCNU_02782 ... 35.8 2.2 gi|183981355|ref|YP_001849646.1| hypothetical protein MMAR_1332 ... 35.8 2.4 gi|15827348|ref|NP_301611.1| hypothetical protein ML0799 [Mycoba... 35.8 2.5 gi|118618029|ref|YP_906361.1| hypothetical protein MUL_2547 [Myc... 35.0 3.7 gi|283458263|ref|YP_003362882.1| hypothetical protein RMDY18_123... 34.7 4.9 gi|120402776|ref|YP_952605.1| ybaK/ebsC protein [Mycobacterium v... 33.5 9.8 >gi|31794404|ref|NP_856897.1| hypothetical protein Mb3252 [Mycobacterium bovis AF2122/97] gi|57117076|ref|YP_177946.1| hypothetical protein Rv3224A [Mycobacterium tuberculosis H37Rv] gi|121639113|ref|YP_979337.1| hypothetical protein BCG_3253 [Mycobacterium bovis BCG str. Pasteur 1173P2] 45 more sequence titlesLength=62 Score = 121 bits (304), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 61/62 (99%), Positives = 62/62 (100%), Gaps = 0/62 (0%) Query 1 VRRSASTCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSKLSLKAAGGPRGAQSG 60 +RRSASTCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSKLSLKAAGGPRGAQSG Sbjct 1 MRRSASTCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSKLSLKAAGGPRGAQSG 60 Query 61 HG 62 HG Sbjct 61 HG 62 >gi|148824425|ref|YP_001289179.1| hypothetical protein TBFG_13252 [Mycobacterium tuberculosis F11] gi|148722952|gb|ABR07577.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] Length=62 Score = 119 bits (298), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 60/62 (97%), Positives = 61/62 (99%), Gaps = 0/62 (0%) Query 1 VRRSASTCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSKLSLKAAGGPRGAQSG 60 +RRSASTCGWKTPTRRGTSRPSDSKTL LELPDERAVAIVPVPSKLSLKAAGGPRGAQSG Sbjct 1 MRRSASTCGWKTPTRRGTSRPSDSKTLSLELPDERAVAIVPVPSKLSLKAAGGPRGAQSG 60 Query 61 HG 62 HG Sbjct 61 HG 62 >gi|340628204|ref|YP_004746656.1| hypothetical protein MCAN_32431 [Mycobacterium canettii CIPT 140010059] gi|340006394|emb|CCC45574.1| putative uncharacterized protein [Mycobacterium canettii CIPT 140010059] Length=70 Score = 41.2 bits (95), Expect = 0.054, Method: Compositional matrix adjust. Identities = 19/22 (87%), Positives = 21/22 (96%), Gaps = 0/22 (0%) Query 1 VRRSASTCGWKTPTRRGTSRPS 22 ++RSASTCGWKTPTR GTSRPS Sbjct 1 MQRSASTCGWKTPTRLGTSRPS 22 >gi|254819141|ref|ZP_05224142.1| hypothetical protein MintA_04404 [Mycobacterium intracellulare ATCC 13950] Length=152 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 21/32 (66%), Positives = 23/32 (72%), Gaps = 0/32 (0%) Query 25 KTLILELPDERAVAIVPVPSKLSLKAAGGPRG 56 KTLI+ LP E AVAIVPVP +LSLKA G Sbjct 43 KTLIVALPGELAVAIVPVPWRLSLKAVAAALG 74 >gi|5305776|gb|AAD41809.1|AF144091_3 unknown [Mycobacterium smegmatis str. MC2 155] Length=185 Score = 36.6 bits (83), Expect = 1.4, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%) Query 25 KTLILELPDERAVAIVPVPSKLSLK 49 KTL++ LP AVA+VPVP+KLSLK Sbjct 75 KTLVIALPKGLAVAVVPVPTKLSLK 99 >gi|118470403|ref|YP_886279.1| YbaK/ebsC protein [Mycobacterium smegmatis str. MC2 155] gi|118171690|gb|ABK72586.1| YbaK/ebsC protein [Mycobacterium smegmatis str. MC2 155] Length=163 Score = 36.6 bits (83), Expect = 1.4, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%) Query 25 KTLILELPDERAVAIVPVPSKLSLK 49 KTL++ LP AVA+VPVP+KLSLK Sbjct 53 KTLVIALPKGLAVAVVPVPTKLSLK 77 >gi|326381836|ref|ZP_08203529.1| hypothetical protein SCNU_02782 [Gordonia neofelifaecis NRRL B-59395] gi|326199262|gb|EGD56443.1| hypothetical protein SCNU_02782 [Gordonia neofelifaecis NRRL B-59395] Length=168 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/34 (56%), Positives = 26/34 (77%), Gaps = 1/34 (2%) Query 25 KTLILELPDER-AVAIVPVPSKLSLKAAGGPRGA 57 KTL+++L D R VA++PVP+KLSLK+A GA Sbjct 59 KTLVVDLGDGRLGVAVIPVPAKLSLKSAAKALGA 92 >gi|183981355|ref|YP_001849646.1| hypothetical protein MMAR_1332 [Mycobacterium marinum M] gi|183174681|gb|ACC39791.1| conserved hypothetical membrane protein [Mycobacterium marinum M] Length=151 Score = 35.8 bits (81), Expect = 2.4, Method: Compositional matrix adjust. Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%) Query 25 KTLILELPDERAVAIVPVPSKLS 47 KTLI+ LP E AVA+VPVPS+LS Sbjct 43 KTLIIALPGELAVAVVPVPSRLS 65 >gi|15827348|ref|NP_301611.1| hypothetical protein ML0799 [Mycobacterium leprae TN] gi|221229826|ref|YP_002503242.1| hypothetical protein MLBr_00799 [Mycobacterium leprae Br4923] gi|13092897|emb|CAC30308.1| conserved hypothetical protein [Mycobacterium leprae] gi|219932933|emb|CAR70893.1| conserved hypothetical protein [Mycobacterium leprae Br4923] Length=135 Score = 35.8 bits (81), Expect = 2.5, Method: Compositional matrix adjust. Identities = 17/26 (66%), Positives = 21/26 (81%), Gaps = 0/26 (0%) Query 24 SKTLILELPDERAVAIVPVPSKLSLK 49 SKTLI+ LP E A+AI+ PS+LSLK Sbjct 22 SKTLIIALPRELAIAILSAPSRLSLK 47 >gi|118618029|ref|YP_906361.1| hypothetical protein MUL_2547 [Mycobacterium ulcerans Agy99] gi|118570139|gb|ABL04890.1| conserved hypothetical membrane protein [Mycobacterium ulcerans Agy99] Length=111 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%) Query 25 KTLILELPDERAVAIVPVPSKLS 47 KTL++ LP E AVA+VPVPS+LS Sbjct 3 KTLVIALPGEFAVAVVPVPSRLS 25 >gi|283458263|ref|YP_003362882.1| hypothetical protein RMDY18_12300 [Rothia mucilaginosa DY-18] gi|283134297|dbj|BAI65062.1| uncharacterized conserved protein [Rothia mucilaginosa DY-18] Length=169 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 20/54 (38%), Positives = 30/54 (56%), Gaps = 0/54 (0%) Query 6 STCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSKLSLKAAGGPRGAQS 59 ++ G + + G S KTL++ + AVAIVPV KL++KAA G +S Sbjct 42 TSFGEEAAKKLGASEEQVFKTLLIVHEKDFAVAIVPVSGKLNIKAAAAALGWKS 95 >gi|120402776|ref|YP_952605.1| ybaK/ebsC protein [Mycobacterium vanbaalenii PYR-1] gi|119955594|gb|ABM12599.1| ybaK/ebsC protein [Mycobacterium vanbaalenii PYR-1] Length=178 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%) Query 25 KTLILELPDERAVAIVPVPSKLSLK 49 KTL++ LP VA++PVPSKLSLK Sbjct 69 KTLVVALPKGLGVAVLPVPSKLSLK 93 Lambda K H 0.312 0.129 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131656912128 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40