BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv3613c Length=53 Score E Sequences producing significant alignments: (Bits) Value gi|15610749|ref|NP_218130.1| hypothetical protein Rv3613c [Mycob... 108 4e-22 gi|340628578|ref|YP_004747030.1| hypothetical protein MCAN_36251... 88.6 3e-16 >gi|15610749|ref|NP_218130.1| hypothetical protein Rv3613c [Mycobacterium tuberculosis H37Rv] gi|31794789|ref|NP_857282.1| hypothetical protein Mb3643c [Mycobacterium bovis AF2122/97] gi|121639532|ref|YP_979756.1| hypothetical protein BCG_3677c [Mycobacterium bovis BCG str. Pasteur 1173P2] 23 more sequence titlesLength=53 Score = 108 bits (269), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%) Query 1 MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL 53 MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL Sbjct 1 MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL 53 >gi|340628578|ref|YP_004747030.1| hypothetical protein MCAN_36251 [Mycobacterium canettii CIPT 140010059] gi|340006768|emb|CCC45956.1| hypothetical protein MCAN_36251 [Mycobacterium canettii CIPT 140010059] Length=53 Score = 88.6 bits (218), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%) Query 1 MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL 53 M +MPKL RAFMAGRP ST+TPRQPTGAAPNHVRALDDSIDPSSAP ARAAL Sbjct 1 MHSMPKLRRAFMAGRPPRSTWTPRQPTGAAPNHVRALDDSIDPSSAPVARAAL 53 Lambda K H 0.320 0.130 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 130244412240 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40