BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv3656c Length=68 Score E Sequences producing significant alignments: (Bits) Value gi|15610792|ref|NP_218173.1| hypothetical protein Rv3656c [Mycob... 129 1e-28 gi|167970801|ref|ZP_02553078.1| hypothetical protein MtubH3_2328... 126 9e-28 gi|296169271|ref|ZP_06850916.1| conserved hypothetical protein [... 105 3e-21 gi|118619397|ref|YP_907729.1| hypothetical protein MUL_4229 [Myc... 102 1e-20 gi|342862009|ref|ZP_08718653.1| hypothetical protein MCOL_24080 ... 100 1e-19 gi|333992578|ref|YP_004525192.1| hypothetical protein JDM601_393... 99.4 1e-19 gi|240173497|ref|ZP_04752155.1| hypothetical protein MkanA1_2957... 98.2 4e-19 gi|118464981|ref|YP_879792.1| hypothetical protein MAV_0511 [Myc... 96.7 1e-18 gi|336460805|gb|EGO39690.1| hypothetical protein MAPs_36250 [Myc... 96.3 1e-18 gi|41406517|ref|NP_959353.1| hypothetical protein MAP0419 [Mycob... 96.3 1e-18 gi|108801765|ref|YP_641962.1| hypothetical protein Mmcs_4802 [My... 93.2 1e-17 gi|126437753|ref|YP_001073444.1| hypothetical protein Mjls_5189 ... 92.0 3e-17 gi|111021319|ref|YP_704291.1| hypothetical protein RHA1_ro04343 ... 89.0 2e-16 gi|315446282|ref|YP_004079161.1| hypothetical protein Mspyr1_478... 86.3 2e-15 gi|326383470|ref|ZP_08205157.1| hypothetical protein SCNU_11056 ... 83.6 8e-15 gi|120406352|ref|YP_956181.1| hypothetical protein Mvan_5404 [My... 83.6 9e-15 gi|226303996|ref|YP_002763954.1| hypothetical protein RER_05070 ... 82.4 2e-14 gi|343926488|ref|ZP_08765993.1| hypothetical protein GOALK_060_0... 82.0 3e-14 gi|312138013|ref|YP_004005349.1| membrane protein [Rhodococcus e... 82.0 3e-14 gi|169627577|ref|YP_001701226.1| hypothetical protein MAB_0473 [... 80.5 9e-14 gi|213966045|ref|ZP_03394234.1| conserved hypothetical protein [... 80.1 1e-13 gi|15843269|ref|NP_338306.1| hypothetical protein MT3756.3 [Myco... 79.3 2e-13 gi|229494815|ref|ZP_04388571.1| conserved hypothetical protein [... 77.4 7e-13 gi|226363663|ref|YP_002781445.1| hypothetical protein ROP_42530 ... 76.3 1e-12 gi|296394988|ref|YP_003659872.1| hypothetical protein Srot_2606 ... 75.5 2e-12 gi|54022326|ref|YP_116568.1| hypothetical protein nfa3620 [Nocar... 75.5 3e-12 gi|317508887|ref|ZP_07966526.1| hypothetical protein HMPREF9336_... 72.0 2e-11 gi|319949004|ref|ZP_08023103.1| hypothetical protein ES5_06372 [... 71.2 4e-11 gi|296141573|ref|YP_003648816.1| hypothetical protein Tpau_3905 ... 63.2 1e-08 gi|227487254|ref|ZP_03917570.1| conserved hypothetical protein [... 62.4 2e-08 gi|334564792|ref|ZP_08517783.1| hypothetical protein CbovD2_0947... 61.6 4e-08 gi|284989193|ref|YP_003407747.1| hypothetical protein Gobs_0595 ... 57.0 8e-07 gi|297193032|ref|ZP_06910430.1| conserved hypothetical protein [... 55.5 3e-06 gi|297159258|gb|ADI08970.1| hypothetical protein SBI_05850 [Stre... 53.9 8e-06 gi|345016204|ref|YP_004818558.1| hypothetical protein Strvi_8980... 53.5 9e-06 gi|330465241|ref|YP_004402984.1| hypothetical protein VAB18032_0... 53.5 9e-06 gi|309810826|ref|ZP_07704627.1| conserved hypothetical protein [... 53.5 1e-05 gi|320009995|gb|ADW04845.1| hypothetical protein Sfla_3424 [Stre... 53.1 1e-05 gi|311896984|dbj|BAJ29392.1| hypothetical protein KSE_35880 [Kit... 52.8 2e-05 gi|328883370|emb|CCA56609.1| small membrane protein [Streptomyce... 52.8 2e-05 gi|331694286|ref|YP_004330525.1| hypothetical protein Psed_0400 ... 52.4 2e-05 gi|291303311|ref|YP_003514589.1| hypothetical protein Snas_5867 ... 51.6 4e-05 gi|154508103|ref|ZP_02043745.1| hypothetical protein ACTODO_0059... 51.2 5e-05 gi|326777719|ref|ZP_08236984.1| hypothetical protein SACT1_3562 ... 51.2 5e-05 gi|159039933|ref|YP_001539186.1| hypothetical protein Sare_4418 ... 51.2 5e-05 gi|239989552|ref|ZP_04710216.1| hypothetical protein SrosN1_1978... 50.8 7e-05 gi|145596547|ref|YP_001160844.1| hypothetical protein Strop_4036... 50.8 7e-05 gi|172041534|ref|YP_001801248.1| hypothetical protein cur_1855 [... 50.4 7e-05 gi|336326567|ref|YP_004606533.1| hypothetical protein CRES_2016 ... 50.4 8e-05 gi|333917960|ref|YP_004491541.1| hypothetical protein AS9A_0282 ... 50.1 1e-04 >gi|15610792|ref|NP_218173.1| hypothetical protein Rv3656c [Mycobacterium tuberculosis H37Rv] gi|31794826|ref|NP_857319.1| hypothetical protein Mb3680c [Mycobacterium bovis AF2122/97] gi|121639569|ref|YP_979793.1| hypothetical protein BCG_3714c [Mycobacterium bovis BCG str. Pasteur 1173P2] 67 more sequence titles Length=68 Score = 129 bits (324), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%), Gaps = 0/68 (0%) Query 1 MLVITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRII 60 MLVITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRII Sbjct 1 MLVITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRII 60 Query 61 GRALSTKV 68 GRALSTKV Sbjct 61 GRALSTKV 68 >gi|167970801|ref|ZP_02553078.1| hypothetical protein MtubH3_23280 [Mycobacterium tuberculosis H37Ra] Length=68 Score = 126 bits (317), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 67/68 (99%), Positives = 67/68 (99%), Gaps = 0/68 (0%) Query 1 MLVITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRII 60 MLVITMF VLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRII Sbjct 1 MLVITMFSVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRII 60 Query 61 GRALSTKV 68 GRALSTKV Sbjct 61 GRALSTKV 68 >gi|296169271|ref|ZP_06850916.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295896063|gb|EFG75736.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length=63 Score = 105 bits (262), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 55/63 (88%), Positives = 58/63 (93%), Gaps = 0/63 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 MFR LVAR+T LA DESGMSTVEYAIGT+AAAAFGAILYTVVTGDSIVSAL IIGRAL+ Sbjct 1 MFRGLVARVTVLAADESGMSTVEYAIGTVAAAAFGAILYTVVTGDSIVSALTNIIGRALN 60 Query 66 TKV 68 TKV Sbjct 61 TKV 63 >gi|118619397|ref|YP_907729.1| hypothetical protein MUL_4229 [Mycobacterium ulcerans Agy99] gi|183985113|ref|YP_001853404.1| hypothetical protein MMAR_5144 [Mycobacterium marinum M] gi|118571507|gb|ABL06258.1| conserved hypothetical membrane protein [Mycobacterium ulcerans Agy99] gi|183178439|gb|ACC43549.1| conserved hypothetical membrane protein [Mycobacterium marinum M] Length=66 Score = 102 bits (255), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 +FRV++AR+T LA D+SGMSTVEYA+GTIAAAAFGAILYTVVTGDS+VSAL RII RALS Sbjct 4 IFRVMLARLTLLATDDSGMSTVEYALGTIAAAAFGAILYTVVTGDSVVSALTRIITRALS 63 Query 66 TKV 68 TKV Sbjct 64 TKV 66 >gi|342862009|ref|ZP_08718653.1| hypothetical protein MCOL_24080 [Mycobacterium colombiense CECT 3035] gi|342130549|gb|EGT83858.1| hypothetical protein MCOL_24080 [Mycobacterium colombiense CECT 3035] Length=66 Score = 100 bits (248), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 51/65 (79%), Positives = 55/65 (85%), Gaps = 0/65 (0%) Query 4 ITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRA 63 + MFR AR+ L DESGMSTVEYAIGTIAAAAFGA+LYTVVTGDSIVSAL IIGRA Sbjct 2 VNMFREFAARVAVLVADESGMSTVEYAIGTIAAAAFGAVLYTVVTGDSIVSALTNIIGRA 61 Query 64 LSTKV 68 L+TKV Sbjct 62 LNTKV 66 >gi|333992578|ref|YP_004525192.1| hypothetical protein JDM601_3938 [Mycobacterium sp. JDM601] gi|333488546|gb|AEF37938.1| conserved hypothetical protein [Mycobacterium sp. JDM601] Length=73 Score = 99.4 bits (246), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 50/62 (81%), Positives = 56/62 (91%), Gaps = 0/62 (0%) Query 7 FRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALST 66 FR + ++ LA DESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIV+ALNR+IGRAL+T Sbjct 12 FRSVQLKLMLLAADESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVAALNRVIGRALNT 71 Query 67 KV 68 KV Sbjct 72 KV 73 >gi|240173497|ref|ZP_04752155.1| hypothetical protein MkanA1_29571 [Mycobacterium kansasii ATCC 12478] Length=66 Score = 98.2 bits (243), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 48/63 (77%), Positives = 55/63 (88%), Gaps = 0/63 (0%) Query 5 TMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRAL 64 +F + AR++ L DESGMSTVEYAIGT+AAAAFGAILY+VVTGDS+VSALN IIGRAL Sbjct 3 NIFHAISARISLLVTDESGMSTVEYAIGTVAAAAFGAILYSVVTGDSVVSALNHIIGRAL 62 Query 65 STK 67 STK Sbjct 63 STK 65 >gi|118464981|ref|YP_879792.1| hypothetical protein MAV_0511 [Mycobacterium avium 104] gi|254773481|ref|ZP_05214997.1| hypothetical protein MaviaA2_02220 [Mycobacterium avium subsp. avium ATCC 25291] gi|118166268|gb|ABK67165.1| conserved hypothetical protein [Mycobacterium avium 104] Length=66 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 50/63 (80%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 +FR AR+ L DESGMSTVEYAIGTIAAAAFGA+LYTVVTGDSIVSAL IIGRAL+ Sbjct 4 VFRKFSARVAVLVADESGMSTVEYAIGTIAAAAFGAVLYTVVTGDSIVSALTNIIGRALN 63 Query 66 TKV 68 TKV Sbjct 64 TKV 66 >gi|336460805|gb|EGO39690.1| hypothetical protein MAPs_36250 [Mycobacterium avium subsp. paratuberculosis S397] Length=66 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 50/63 (80%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 +FR AR+ L DESGMSTVEYAIGTIAAAAFGA+LYTVVTGDSIVSAL IIGRAL+ Sbjct 4 VFREFSARVAVLVADESGMSTVEYAIGTIAAAAFGAVLYTVVTGDSIVSALTNIIGRALN 63 Query 66 TKV 68 TKV Sbjct 64 TKV 66 >gi|41406517|ref|NP_959353.1| hypothetical protein MAP0419 [Mycobacterium avium subsp. paratuberculosis K-10] gi|41394866|gb|AAS02736.1| hypothetical protein MAP_0419 [Mycobacterium avium subsp. paratuberculosis K-10] Length=67 Score = 96.3 bits (238), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 50/63 (80%), Positives = 54/63 (86%), Gaps = 0/63 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 +FR AR+ L DESGMSTVEYAIGTIAAAAFGA+LYTVVTGDSIVSAL IIGRAL+ Sbjct 5 VFREFSARVAVLVADESGMSTVEYAIGTIAAAAFGAVLYTVVTGDSIVSALTNIIGRALN 64 Query 66 TKV 68 TKV Sbjct 65 TKV 67 >gi|108801765|ref|YP_641962.1| hypothetical protein Mmcs_4802 [Mycobacterium sp. MCS] gi|119870916|ref|YP_940868.1| hypothetical protein Mkms_4888 [Mycobacterium sp. KMS] gi|108772184|gb|ABG10906.1| conserved hypothetical protein [Mycobacterium sp. MCS] gi|119697005|gb|ABL94078.1| conserved hypothetical protein [Mycobacterium sp. KMS] Length=68 Score = 93.2 bits (230), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 48/59 (82%), Positives = 53/59 (90%), Gaps = 0/59 (0%) Query 10 LVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 L AR+T LAVD++GMSTVEYAIGT+AAAAFGAILYTVVTGDSIVSAL II RAL+T V Sbjct 10 LQARLTVLAVDDAGMSTVEYAIGTVAAAAFGAILYTVVTGDSIVSALTNIISRALNTNV 68 >gi|126437753|ref|YP_001073444.1| hypothetical protein Mjls_5189 [Mycobacterium sp. JLS] gi|126237553|gb|ABO00954.1| conserved hypothetical protein [Mycobacterium sp. JLS] Length=68 Score = 92.0 bits (227), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 0/59 (0%) Query 10 LVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 L AR+T LAVD++GMSTVEYAIGT+AAAAFGAILYTVVTGDSI+SAL II RAL+T V Sbjct 10 LQARLTVLAVDDAGMSTVEYAIGTVAAAAFGAILYTVVTGDSIMSALTNIISRALNTNV 68 >gi|111021319|ref|YP_704291.1| hypothetical protein RHA1_ro04343 [Rhodococcus jostii RHA1] gi|110820849|gb|ABG96133.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length=72 Score = 89.0 bits (219), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 45/61 (74%), Positives = 52/61 (86%), Gaps = 0/61 (0%) Query 8 RVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 R L+AR+T LA DE GMST EYAIGTIAAAAFGA+LY+VVTGDSIV+AL II +AL+T Sbjct 12 RALIARLTLLATDEDGMSTAEYAIGTIAAAAFGAVLYSVVTGDSIVTALTNIIDKALNTA 71 Query 68 V 68 V Sbjct 72 V 72 >gi|315446282|ref|YP_004079161.1| hypothetical protein Mspyr1_47860 [Mycobacterium sp. Spyr1] gi|315264585|gb|ADU01327.1| hypothetical protein Mspyr1_47860 [Mycobacterium sp. Spyr1] Length=67 Score = 86.3 bits (212), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 46/56 (83%), Positives = 48/56 (86%), Gaps = 0/56 (0%) Query 13 RMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 R+ LAV + GMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSAL II RALST V Sbjct 12 RLVLLAVADDGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALTNIINRALSTNV 67 >gi|326383470|ref|ZP_08205157.1| hypothetical protein SCNU_11056 [Gordonia neofelifaecis NRRL B-59395] gi|326197876|gb|EGD55063.1| hypothetical protein SCNU_11056 [Gordonia neofelifaecis NRRL B-59395] Length=73 Score = 83.6 bits (205), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 43/51 (85%), Positives = 46/51 (91%), Gaps = 0/51 (0%) Query 17 LAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 LAVDE GMST EYAIGTIAAAAFGA+LYTVVTGDS+VSAL IIG+ALST Sbjct 21 LAVDEEGMSTAEYAIGTIAAAAFGALLYTVVTGDSVVSALTGIIGKALSTS 71 >gi|120406352|ref|YP_956181.1| hypothetical protein Mvan_5404 [Mycobacterium vanbaalenii PYR-1] gi|119959170|gb|ABM16175.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] Length=66 Score = 83.6 bits (205), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%) Query 7 FRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALST 66 R + R+ LAV + GMSTVEYAIGTIAAAAFGAILYTVVTGDSIV+AL II RAL+T Sbjct 5 LRDIRTRLLVLAVADDGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVTALTNIISRALNT 64 Query 67 KV 68 V Sbjct 65 NV 66 >gi|226303996|ref|YP_002763954.1| hypothetical protein RER_05070 [Rhodococcus erythropolis PR4] gi|226183111|dbj|BAH31215.1| conserved hypothetical protein [Rhodococcus erythropolis PR4] Length=67 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 43/62 (70%), Positives = 48/62 (78%), Gaps = 0/62 (0%) Query 7 FRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALST 66 FR + AR L ++ GMST EYAIGTIAAAAFGA+LYTVVTGDSIVSAL II +AL T Sbjct 6 FRTMSARFALLVTEDDGMSTAEYAIGTIAAAAFGAVLYTVVTGDSIVSALTGIIDKALKT 65 Query 67 KV 68 V Sbjct 66 AV 67 >gi|343926488|ref|ZP_08765993.1| hypothetical protein GOALK_060_01520 [Gordonia alkanivorans NBRC 16433] gi|343763726|dbj|GAA12919.1| hypothetical protein GOALK_060_01520 [Gordonia alkanivorans NBRC 16433] Length=71 Score = 82.0 bits (201), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 43/57 (76%), Positives = 47/57 (83%), Gaps = 0/57 (0%) Query 12 ARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 A T L DE GMST EYAIGTIAAAAFGAILYTV+TGD+IVSAL IIG+AL+T V Sbjct 14 AHATRLITDEDGMSTAEYAIGTIAAAAFGAILYTVITGDNIVSALTGIIGKALNTSV 70 >gi|312138013|ref|YP_004005349.1| membrane protein [Rhodococcus equi 103S] gi|325675224|ref|ZP_08154909.1| hypothetical protein HMPREF0724_12691 [Rhodococcus equi ATCC 33707] gi|311887352|emb|CBH46663.1| putative membrane protein [Rhodococcus equi 103S] gi|325553930|gb|EGD23607.1| hypothetical protein HMPREF0724_12691 [Rhodococcus equi ATCC 33707] Length=67 Score = 82.0 bits (201), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 44/63 (70%), Positives = 50/63 (80%), Gaps = 0/63 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 MFR + AR+ A + GMST EYAIGTIAAAAFGA+LYTVVTGDSIVSAL II +AL+ Sbjct 5 MFRGVQARIMTAATGDDGMSTAEYAIGTIAAAAFGAVLYTVVTGDSIVSALTGIIDKALA 64 Query 66 TKV 68 T V Sbjct 65 TSV 67 >gi|169627577|ref|YP_001701226.1| hypothetical protein MAB_0473 [Mycobacterium abscessus ATCC 19977] gi|169239544|emb|CAM60572.1| Conserved hypothetical protein [Mycobacterium abscessus] Length=68 Score = 80.5 bits (197), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%) Query 21 ESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 E GMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSAL II RAL+T V Sbjct 21 EDGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALTNIIARALNTSV 68 >gi|213966045|ref|ZP_03394234.1| conserved hypothetical protein [Corynebacterium amycolatum SK46] gi|213951340|gb|EEB62733.1| conserved hypothetical protein [Corynebacterium amycolatum SK46] Length=90 Score = 80.1 bits (196), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 41/59 (70%), Positives = 47/59 (80%), Gaps = 0/59 (0%) Query 10 LVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 L R+ ALA +E+GMSTVEYA+GTIAAAAFGA+LYTVVTG I AL II RAL+T V Sbjct 32 LHKRLHALATEENGMSTVEYALGTIAAAAFGALLYTVVTGGDITQALTDIIERALNTDV 90 >gi|15843269|ref|NP_338306.1| hypothetical protein MT3756.3 [Mycobacterium tuberculosis CDC1551] gi|13883627|gb|AAK48120.1| hypothetical protein MT3756.3 [Mycobacterium tuberculosis CDC1551] Length=42 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%), Gaps = 0/41 (0%) Query 28 EYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 EYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV Sbjct 2 EYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 42 >gi|229494815|ref|ZP_04388571.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|229318311|gb|EEN84176.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length=59 Score = 77.4 bits (189), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 0/57 (0%) Query 12 ARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 AR L ++ GMST EYAIGTIAAAAFGA+LYTVVTGDSIVSAL II +AL T V Sbjct 3 ARFALLVTEDDGMSTAEYAIGTIAAAAFGAVLYTVVTGDSIVSALTGIIDKALKTAV 59 >gi|226363663|ref|YP_002781445.1| hypothetical protein ROP_42530 [Rhodococcus opacus B4] gi|226242152|dbj|BAH52500.1| hypothetical membrane protein [Rhodococcus opacus B4] Length=72 Score = 76.3 bits (186), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%) Query 20 DESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 DE GMST EYAIGTIAAAAFGA+LY+VVTGDSIV+AL II +AL+T V Sbjct 24 DEDGMSTAEYAIGTIAAAAFGAVLYSVVTGDSIVTALTNIIDKALNTAV 72 >gi|296394988|ref|YP_003659872.1| hypothetical protein Srot_2606 [Segniliparus rotundus DSM 44985] gi|296182135|gb|ADG99041.1| hypothetical protein Srot_2606 [Segniliparus rotundus DSM 44985] Length=76 Score = 75.5 bits (184), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%) Query 10 LVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 L+ R+ A +E GMSTVEYAIGT+AAAAFGA+LYTV+TG S+ S L +II +AL+T V Sbjct 18 LLCRIAAFGGEEEGMSTVEYAIGTVAAAAFGALLYTVLTGGSVASFLQKIIEKALTTSV 76 >gi|54022326|ref|YP_116568.1| hypothetical protein nfa3620 [Nocardia farcinica IFM 10152] gi|54013834|dbj|BAD55204.1| hypothetical protein [Nocardia farcinica IFM 10152] Length=749 Score = 75.5 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%) Query 10 LVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 L R+ AV + GMST EYAIGTIAAAAFGA+LY VVTGDSIV AL +II +AL+T V Sbjct 691 LRTRLLHAAVADDGMSTAEYAIGTIAAAAFGAVLYGVVTGDSIVDALTKIIDKALNTSV 749 >gi|317508887|ref|ZP_07966526.1| hypothetical protein HMPREF9336_02898 [Segniliparus rugosus ATCC BAA-974] gi|316252848|gb|EFV12279.1| hypothetical protein HMPREF9336_02898 [Segniliparus rugosus ATCC BAA-974] Length=71 Score = 72.0 bits (175), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/49 (72%), Positives = 42/49 (86%), Gaps = 0/49 (0%) Query 20 DESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 +E GMSTVEYAIGT+AAAAFGA+LYTVVTG S+ S L +II +AL+T V Sbjct 23 NEEGMSTVEYAIGTVAAAAFGAVLYTVVTGGSVASFLQKIIEKALTTGV 71 >gi|319949004|ref|ZP_08023103.1| hypothetical protein ES5_06372 [Dietzia cinnamea P4] gi|319437332|gb|EFV92353.1| hypothetical protein ES5_06372 [Dietzia cinnamea P4] Length=94 Score = 71.2 bits (173), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 37/56 (67%), Positives = 45/56 (81%), Gaps = 0/56 (0%) Query 13 RMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 R A+ ++GMSTVEYA+GTIAAAAFGA+LYTVV+GDSI AL II +AL+T V Sbjct 39 RFHAVTSADAGMSTVEYAVGTIAAAAFGAVLYTVVSGDSIPDALGGIIEQALNTSV 94 >gi|296141573|ref|YP_003648816.1| hypothetical protein Tpau_3905 [Tsukamurella paurometabola DSM 20162] gi|296029707|gb|ADG80477.1| hypothetical protein Tpau_3905 [Tsukamurella paurometabola DSM 20162] Length=54 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 32/47 (69%), Positives = 36/47 (77%), Gaps = 0/47 (0%) Query 6 MFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSI 52 M+ L RMT L + E GMSTVEYAIGTIAAAAFGA+LY VVTG + Sbjct 1 MWIRLRCRMTELMMQEEGMSTVEYAIGTIAAAAFGAVLYGVVTGCQV 47 >gi|227487254|ref|ZP_03917570.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227541579|ref|ZP_03971628.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51866] gi|227092912|gb|EEI28224.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227182547|gb|EEI63519.1| conserved hypothetical protein [Corynebacterium glucuronolyticum ATCC 51866] Length=60 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 31/59 (53%), Positives = 42/59 (72%), Gaps = 0/59 (0%) Query 9 VLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 + V R+ L VD+ GMS+VEYA+GT+AAAA +LYT+VTGDS+ SAL + AL + Sbjct 1 MFVNRIRHLFVDDLGMSSVEYALGTMAAAALAGVLYTIVTGDSVTSALEGMFTDALHNR 59 >gi|334564792|ref|ZP_08517783.1| hypothetical protein CbovD2_09471 [Corynebacterium bovis DSM 20582] Length=140 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%) Query 14 MTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 +T +A D+ GMST+EYA+G +AAAA G +LYTVVT D++ +AL II AL T+ Sbjct 85 VTTVARDDGGMSTIEYALGMVAAAALGTLLYTVVTSDAVETALTEIIQNALDTR 138 >gi|284989193|ref|YP_003407747.1| hypothetical protein Gobs_0595 [Geodermatophilus obscurus DSM 43160] gi|284062438|gb|ADB73376.1| hypothetical protein Gobs_0595 [Geodermatophilus obscurus DSM 43160] Length=89 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 28/49 (58%), Positives = 37/49 (76%), Gaps = 0/49 (0%) Query 18 AVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALST 66 A E+GMST EYA+GT+AA AF A+LY VVTG S+V L+ ++ AL+T Sbjct 39 AAGEAGMSTAEYAVGTVAACAFAAVLYRVVTGGSVVDGLSALVADALAT 87 >gi|297193032|ref|ZP_06910430.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|197719838|gb|EDY63746.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length=66 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 29/65 (45%), Positives = 43/65 (67%), Gaps = 3/65 (4%) Query 6 MFRVLVARMTALAVD---ESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGR 62 M++ + R+TAL + GM+T EYA+GTIAA AF A+LY +VT ++ AL +IG+ Sbjct 1 MWQAMRVRLTALRRRMRTDDGMTTSEYAMGTIAACAFAAVLYKIVTSGTVSGALEAVIGK 60 Query 63 ALSTK 67 AL + Sbjct 61 ALDAQ 65 >gi|297159258|gb|ADI08970.1| hypothetical protein SBI_05850 [Streptomyces bingchenggensis BCW-1] Length=65 Score = 53.9 bits (128), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%) Query 23 GMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 GM+T EYA+GT+AA AF A+LY VVTG ++ AL +IG+AL + Sbjct 20 GMATAEYAMGTLAACAFAAVLYKVVTGGAVDEALRSMIGKALDGQ 64 >gi|345016204|ref|YP_004818558.1| hypothetical protein Strvi_8980 [Streptomyces violaceusniger Tu 4113] gi|344042553|gb|AEM88278.1| hypothetical protein Strvi_8980 [Streptomyces violaceusniger Tu 4113] Length=65 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 25/45 (56%), Positives = 32/45 (72%), Gaps = 0/45 (0%) Query 23 GMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 GM+T EYA+GTIAA F A+LY VVT ++ AL +IGRAL + Sbjct 20 GMATAEYAMGTIAACGFAAVLYKVVTSGTVSDALQSVIGRALDAQ 64 >gi|330465241|ref|YP_004402984.1| hypothetical protein VAB18032_06300 [Verrucosispora maris AB-18-032] gi|328808212|gb|AEB42384.1| hypothetical protein VAB18032_06300 [Verrucosispora maris AB-18-032] Length=52 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%) Query 21 ESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 ++GM+T EYA+GT+AA AFG IL V+T DS+ SAL +I RAL Sbjct 8 DAGMNTAEYAVGTLAAVAFGGILLKVLTSDSVQSALAAVIDRALK 52 >gi|309810826|ref|ZP_07704627.1| conserved hypothetical protein [Dermacoccus sp. Ellin185] gi|308435132|gb|EFP58963.1| conserved hypothetical protein [Dermacoccus sp. Ellin185] Length=70 Score = 53.5 bits (127), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 27/47 (58%), Positives = 33/47 (71%), Gaps = 0/47 (0%) Query 21 ESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 E GMST EYA+GTIAA AF A+L +V D++ SAL I ALST+ Sbjct 24 EHGMSTAEYAVGTIAAVAFAAVLIAIVKSDTVRSALEGIFSSALSTR 70 >gi|320009995|gb|ADW04845.1| hypothetical protein Sfla_3424 [Streptomyces flavogriseus ATCC 33331] Length=91 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%) Query 7 FRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALST 66 +R R + GM+T EYA+GTIAA AF A+LY VVT +++SAL +I AL Sbjct 30 WRARFGRRAGCGGLDRGMTTSEYAVGTIAACAFAAVLYKVVTSGAVLSALQSLIKGALDA 89 Query 67 K 67 K Sbjct 90 K 90 >gi|311896984|dbj|BAJ29392.1| hypothetical protein KSE_35880 [Kitasatospora setae KM-6054] Length=83 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 25/53 (48%), Positives = 37/53 (70%), Gaps = 0/53 (0%) Query 13 RMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 R A ++GM+T EYAIGT+AA AF A+LY VVT +++ AL+ ++ R+L Sbjct 29 RRVAAGPPDAGMNTAEYAIGTVAACAFAAVLYKVVTSETVSGALSGLLERSLH 81 >gi|328883370|emb|CCA56609.1| small membrane protein [Streptomyces venezuelae ATCC 10712] Length=76 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 24/44 (55%), Positives = 34/44 (78%), Gaps = 0/44 (0%) Query 21 ESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRAL 64 ++GM+T EYA+GTIAAA F A+LY +VT ++ AL +IG+AL Sbjct 29 DAGMTTSEYAVGTIAAAGFAAVLYKIVTSGAVSGALESVIGKAL 72 >gi|331694286|ref|YP_004330525.1| hypothetical protein Psed_0400 [Pseudonocardia dioxanivorans CB1190] gi|326948975|gb|AEA22672.1| hypothetical protein Psed_0400 [Pseudonocardia dioxanivorans CB1190] Length=84 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 31/46 (68%), Positives = 41/46 (90%), Gaps = 0/46 (0%) Query 23 GMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV 68 GMSTVEYAIGT+AAAAF A+LY+VV+G+++V+AL ++ RALST V Sbjct 39 GMSTVEYAIGTLAAAAFAAVLYSVVSGENVVTALTGLVERALSTTV 84 >gi|291303311|ref|YP_003514589.1| hypothetical protein Snas_5867 [Stackebrandtia nassauensis DSM 44728] gi|290572531|gb|ADD45496.1| hypothetical protein Snas_5867 [Stackebrandtia nassauensis DSM 44728] Length=42 Score = 51.6 bits (122), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%) Query 24 MSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 MST EYA+GTIAA AF ++ V+T D++ ALN II RALS Sbjct 1 MSTAEYAVGTIAAVAFAGLMLKVLTSDAVYKALNDIIARALS 42 >gi|154508103|ref|ZP_02043745.1| hypothetical protein ACTODO_00596 [Actinomyces odontolyticus ATCC 17982] gi|153797737|gb|EDN80157.1| hypothetical protein ACTODO_00596 [Actinomyces odontolyticus ATCC 17982] Length=90 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 29/64 (46%), Positives = 39/64 (61%), Gaps = 4/64 (6%) Query 8 RVLVARMTALAVD----ESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRA 63 R L R TA + E G +TVEYAIGTIAAA F +L ++ D++ +AL II A Sbjct 27 RALRPRTTAEPTEGRDPEEGATTVEYAIGTIAAAGFAGLLIVILKSDTVRAALESIIQEA 86 Query 64 LSTK 67 L+T+ Sbjct 87 LNTR 90 >gi|326777719|ref|ZP_08236984.1| hypothetical protein SACT1_3562 [Streptomyces cf. griseus XylebKG-1] gi|326658052|gb|EGE42898.1| hypothetical protein SACT1_3562 [Streptomyces griseus XylebKG-1] Length=88 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/59 (48%), Positives = 36/59 (62%), Gaps = 1/59 (1%) Query 10 LVARMTA-LAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 VAR L + GM+T EYA+GTIAA AF A+LY VV ++SAL ++ AL K Sbjct 29 WVARWAGRLGRSDRGMTTSEYAVGTIAACAFAAVLYKVVNSGPVLSALQSLVEDALDAK 87 >gi|159039933|ref|YP_001539186.1| hypothetical protein Sare_4418 [Salinispora arenicola CNS-205] gi|157918768|gb|ABW00196.1| conserved hypothetical protein [Salinispora arenicola CNS-205] Length=55 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/57 (50%), Positives = 39/57 (69%), Gaps = 4/57 (7%) Query 8 RVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRAL 64 R L+AR+ ++GM+T EYA+GT+AA AF +L V+T DS+ SAL +I RAL Sbjct 2 RRLLARLRG----DAGMNTAEYAVGTLAAVAFAGLLLKVLTSDSVQSALAAVIDRAL 54 >gi|239989552|ref|ZP_04710216.1| hypothetical protein SrosN1_19786 [Streptomyces roseosporus NRRL 11379] gi|291446570|ref|ZP_06585960.1| predicted protein [Streptomyces roseosporus NRRL 15998] gi|291349517|gb|EFE76421.1| predicted protein [Streptomyces roseosporus NRRL 15998] Length=88 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 25/51 (50%), Positives = 33/51 (65%), Gaps = 0/51 (0%) Query 17 LAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 L + GM+T EYA+GTIAA AF A+LY VV ++SAL ++ AL K Sbjct 37 LGRSDRGMTTSEYAVGTIAACAFAAVLYKVVNSGPVLSALQSLVEDALDAK 87 >gi|145596547|ref|YP_001160844.1| hypothetical protein Strop_4036 [Salinispora tropica CNB-440] gi|145305884|gb|ABP56466.1| hypothetical protein Strop_4036 [Salinispora tropica CNB-440] Length=57 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 25/53 (48%), Positives = 37/53 (70%), Gaps = 0/53 (0%) Query 13 RMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 R+TA ++GM+T EYA+GT+AA AF +L V+T D++ +AL +I RAL Sbjct 5 RITARLRGDAGMNTAEYAVGTLAAVAFAGLLLKVLTSDNVQTALTAVIDRALQ 57 >gi|172041534|ref|YP_001801248.1| hypothetical protein cur_1855 [Corynebacterium urealyticum DSM 7109] gi|171852838|emb|CAQ05814.1| hypothetical protein cu1855 [Corynebacterium urealyticum DSM 7109] Length=91 Score = 50.4 bits (119), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%) Query 20 DESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALS 65 DESGMST+EYA+G +AAAA GA+LYTVVT D++ SAL+ I RALS Sbjct 43 DESGMSTIEYALGCVAAAALGALLYTVVTSDAVESALSGIFERALS 88 >gi|336326567|ref|YP_004606533.1| hypothetical protein CRES_2016 [Corynebacterium resistens DSM 45100] gi|336102549|gb|AEI10369.1| hypothetical protein CRES_2016 [Corynebacterium resistens DSM 45100] Length=116 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 33/61 (55%), Positives = 42/61 (69%), Gaps = 0/61 (0%) Query 5 TMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRAL 64 T F LVA + DE GMST+EYA+G +AAAA GA+LYTVVT D++ AL+ I +AL Sbjct 52 TAFEKLVAAIRGYMADERGMSTIEYALGCVAAAALGALLYTVVTSDTVEQALSGIFEKAL 111 Query 65 S 65 Sbjct 112 Q 112 >gi|333917960|ref|YP_004491541.1| hypothetical protein AS9A_0282 [Amycolicicoccus subflavus DQS3-9A1] gi|333480181|gb|AEF38741.1| hypothetical protein AS9A_0282 [Amycolicicoccus subflavus DQS3-9A1] Length=79 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 40/61 (66%), Positives = 49/61 (81%), Gaps = 1/61 (1%) Query 8 RVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTK 67 ++V+R+ L +E GMSTVEYAIGTIAAAAF AILYTVVTG+S+V A+ +I RALST Sbjct 20 ELIVSRLQGLQ-EEEGMSTVEYAIGTIAAAAFAAILYTVVTGNSVVGAMTGLIERALSTP 78 Query 68 V 68 V Sbjct 79 V 79 Lambda K H 0.326 0.134 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 129098386704 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40