BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv3770A Length=60 Score E Sequences producing significant alignments: (Bits) Value gi|15843392|ref|NP_338429.1| hypothetical protein MT3878 [Mycoba... 119 1e-25 gi|15609949|ref|NP_217328.1| transposase [Mycobacterium tubercul... 64.7 4e-09 gi|289762987|ref|ZP_06522365.1| transposase [Mycobacterium tuber... 64.7 4e-09 gi|15842348|ref|NP_337385.1| IS1604 transposase [Mycobacterium t... 64.7 4e-09 gi|308369867|ref|ZP_07419332.2| transposase [Mycobacterium tuber... 64.7 4e-09 gi|308232251|ref|ZP_07415431.2| transposase [Mycobacterium tuber... 64.7 4e-09 gi|289575511|ref|ZP_06455738.1| transposase [Mycobacterium tuber... 64.7 4e-09 gi|289758936|ref|ZP_06518314.1| transposase [Mycobacterium tuber... 64.7 5e-09 gi|31793987|ref|NP_856480.1| transposase [Mycobacterium bovis AF... 64.3 6e-09 gi|308375475|ref|ZP_07444053.2| transposase [Mycobacterium tuber... 64.3 6e-09 gi|296169409|ref|ZP_06851031.1| IS1604 transposase [Mycobacteriu... 58.9 3e-07 gi|315441535|ref|YP_004074412.1| Mu transposase/integrase [Mycob... 43.1 0.012 gi|119854966|ref|YP_935571.1| integrase catalytic subunit [Mycob... 43.1 0.012 gi|258655052|ref|YP_003204208.1| Integrase catalytic subunit [Na... 42.7 0.018 gi|336117533|ref|YP_004572301.1| putative transposase [Microluna... 42.0 0.032 gi|145226041|ref|YP_001136695.1| integrase catalytic subunit [My... 40.8 0.061 gi|120401589|ref|YP_951418.1| integrase catalytic subunit [Mycob... 40.0 0.11 gi|226334812|ref|YP_002784484.1| putative transposase [Rhodococc... 40.0 0.13 gi|111026943|ref|YP_708921.1| transposase [Rhodococcus jostii RH... 37.4 0.67 gi|258651521|ref|YP_003200677.1| Integrase catalytic subunit [Na... 37.4 0.69 gi|258653876|ref|YP_003203032.1| Integrase catalytic subunit [Na... 37.4 0.70 gi|253687172|ref|YP_003016362.1| histidine kinase [Pectobacteriu... 35.0 3.3 >gi|15843392|ref|NP_338429.1| hypothetical protein MT3878 [Mycobacterium tuberculosis CDC1551] gi|31794941|ref|NP_857434.1| hypothetical protein Mb3797c [Mycobacterium bovis AF2122/97] gi|57117153|ref|YP_178012.1| hypothetical protein Rv3770A [Mycobacterium tuberculosis H37Rv] 76 more sequence titles Length=60 Score = 119 bits (299), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 59/60 (99%), Positives = 60/60 (100%), Gaps = 0/60 (0%) Query 1 VGSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQLAGDRIALRGRGS 60 +GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQLAGDRIALRGRGS Sbjct 1 MGSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQLAGDRIALRGRGS 60 >gi|15609949|ref|NP_217328.1| transposase [Mycobacterium tuberculosis H37Rv] gi|148662654|ref|YP_001284177.1| putative transposase [Mycobacterium tuberculosis H37Ra] gi|167967615|ref|ZP_02549892.1| putative transposase [Mycobacterium tuberculosis H37Ra] gi|307085512|ref|ZP_07494625.1| transposase [Mycobacterium tuberculosis SUMu012] gi|1648909|emb|CAB03635.1| PROBABLE TRANSPOSASE [Mycobacterium tuberculosis H37Rv] gi|148506806|gb|ABQ74615.1| putative transposase [Mycobacterium tuberculosis H37Ra] gi|308364957|gb|EFP53808.1| transposase [Mycobacterium tuberculosis SUMu012] Length=469 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 82 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 123 >gi|289762987|ref|ZP_06522365.1| transposase [Mycobacterium tuberculosis GM 1503] gi|289710493|gb|EFD74509.1| transposase [Mycobacterium tuberculosis GM 1503] Length=290 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 82 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 123 >gi|15842348|ref|NP_337385.1| IS1604 transposase [Mycobacterium tuberculosis CDC1551] gi|121638691|ref|YP_978915.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|148824001|ref|YP_001288755.1| transposase [Mycobacterium tuberculosis F11] 43 more sequence titles Length=469 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 82 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 123 >gi|308369867|ref|ZP_07419332.2| transposase [Mycobacterium tuberculosis SUMu002] gi|308371137|ref|ZP_07423947.2| transposase [Mycobacterium tuberculosis SUMu003] gi|308374697|ref|ZP_07437023.2| transposase [Mycobacterium tuberculosis SUMu006] 7 more sequence titles Length=460 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 73 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 114 >gi|308232251|ref|ZP_07415431.2| transposase [Mycobacterium tuberculosis SUMu001] gi|308379326|ref|ZP_07485870.2| transposase [Mycobacterium tuberculosis SUMu010] gi|308380479|ref|ZP_07490088.2| transposase [Mycobacterium tuberculosis SUMu011] gi|308214601|gb|EFO74000.1| transposase [Mycobacterium tuberculosis SUMu001] gi|308357470|gb|EFP46321.1| transposase [Mycobacterium tuberculosis SUMu010] gi|308361419|gb|EFP50270.1| transposase [Mycobacterium tuberculosis SUMu011] Length=460 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 73 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 114 >gi|289575511|ref|ZP_06455738.1| transposase [Mycobacterium tuberculosis K85] gi|339632823|ref|YP_004724465.1| transposase [Mycobacterium africanum GM041182] gi|289539942|gb|EFD44520.1| transposase [Mycobacterium tuberculosis K85] gi|339332179|emb|CCC27887.1| putative transposase [Mycobacterium africanum GM041182] Length=469 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 82 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 123 >gi|289758936|ref|ZP_06518314.1| transposase [Mycobacterium tuberculosis T85] gi|289714500|gb|EFD78512.1| transposase [Mycobacterium tuberculosis T85] Length=460 Score = 64.7 bits (156), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 73 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 114 >gi|31793987|ref|NP_856480.1| transposase [Mycobacterium bovis AF2122/97] gi|31619581|emb|CAD95020.1| PUTATIVE TRANSPOSASE [FIRST PART] [Mycobacterium bovis AF2122/97] Length=226 Score = 64.3 bits (155), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 34/48 (71%), Positives = 35/48 (73%), Gaps = 0/48 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQLA 49 G PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 77 GFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLG 124 >gi|308375475|ref|ZP_07444053.2| transposase [Mycobacterium tuberculosis SUMu007] gi|308346188|gb|EFP35039.1| transposase [Mycobacterium tuberculosis SUMu007] Length=428 Score = 64.3 bits (155), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 PNP QCT RTP EVLELAVALR ENP RTA AI+RILR QL Sbjct 41 VPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQL 82 >gi|296169409|ref|ZP_06851031.1| IS1604 transposase [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295895911|gb|EFG75604.1| IS1604 transposase [Mycobacterium parascrofulaceum ATCC BAA-614] Length=468 Score = 58.9 bits (141), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 32/47 (69%), Positives = 34/47 (73%), Gaps = 0/47 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRAQL 48 G P+P QCT RTP EVLELAVALR ENP RTA AI+RIL QL Sbjct 77 GFDALVPSPRQCTPRTPAEVLELAVALRRENPARTAAAIRRILLTQL 123 >gi|315441535|ref|YP_004074412.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315444101|ref|YP_004076980.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315445643|ref|YP_004078522.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315446300|ref|YP_004079179.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315262404|gb|ADT99145.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315263946|gb|ADU00688.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315264603|gb|ADU01345.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] gi|315265190|gb|ADU01931.1| Mu transposase/integrase [Mycobacterium sp. Spyr1] Length=486 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 22/44 (50%), Positives = 27/44 (62%), Gaps = 0/44 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILR 45 G P P + RT V+VLELA +L+ ENP RTA + RILR Sbjct 74 GFEALVPEPRRLATRTDVQVLELAASLKRENPARTAAQVARILR 117 >gi|119854966|ref|YP_935571.1| integrase catalytic subunit [Mycobacterium sp. KMS] gi|119697684|gb|ABL94756.1| Integrase, catalytic region [Mycobacterium sp. KMS] Length=510 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 22/44 (50%), Positives = 27/44 (62%), Gaps = 0/44 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILR 45 G P P + RT V+VLELA +L+ ENP RTA + RILR Sbjct 98 GFEALVPEPRRLATRTDVQVLELAASLKRENPARTAAQVARILR 141 >gi|258655052|ref|YP_003204208.1| Integrase catalytic subunit [Nakamurella multipartita DSM 44233] gi|258558277|gb|ACV81219.1| Integrase catalytic region [Nakamurella multipartita DSM 44233] Length=489 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 0/40 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRA 46 P+P Q R +V ELA AL+ ENPDRT + RILRA Sbjct 79 SPSPRQPGARIDAQVFELAAALKRENPDRTVAQVARILRA 118 >gi|336117533|ref|YP_004572301.1| putative transposase [Microlunatus phosphovorus NM-1] gi|334685313|dbj|BAK34898.1| putative transposase [Microlunatus phosphovorus NM-1] Length=471 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRA 46 P+ Q R VLELAVAL+ ENPDRTA + RILRA Sbjct 82 APSLRQPGSRIDTTVLELAVALKRENPDRTAAQVARILRA 121 >gi|145226041|ref|YP_001136695.1| integrase catalytic subunit [Mycobacterium gilvum PYR-GCK] gi|145218504|gb|ABP47907.1| Integrase, catalytic region [Mycobacterium gilvum PYR-GCK] Length=522 Score = 40.8 bits (94), Expect = 0.061, Method: Compositional matrix adjust. Identities = 21/44 (48%), Positives = 26/44 (60%), Gaps = 0/44 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILR 45 G P P + RT +VLELAV+L+ ENP RT + RILR Sbjct 101 GFEALVPEPRRLGTRTDTQVLELAVSLKRENPARTVAQVARILR 144 >gi|120401589|ref|YP_951418.1| integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1] gi|120402693|ref|YP_952522.1| integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1] gi|120403490|ref|YP_953319.1| integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1] gi|120403911|ref|YP_953740.1| integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1] gi|119954407|gb|ABM11412.1| Integrase, catalytic region [Mycobacterium vanbaalenii PYR-1] gi|119955511|gb|ABM12516.1| Integrase, catalytic region [Mycobacterium vanbaalenii PYR-1] gi|119956308|gb|ABM13313.1| Integrase, catalytic region [Mycobacterium vanbaalenii PYR-1] gi|119956729|gb|ABM13734.1| Integrase, catalytic region [Mycobacterium vanbaalenii PYR-1] Length=499 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 20/44 (46%), Positives = 25/44 (57%), Gaps = 0/44 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILR 45 G P P + RT +VLELA +L+ ENP RT + RILR Sbjct 74 GFEALVPEPRRLATRTDTQVLELAASLKRENPARTVAQVARILR 117 >gi|226334812|ref|YP_002784484.1| putative transposase [Rhodococcus opacus B4] gi|226246032|dbj|BAH56132.1| putative transposase [Rhodococcus opacus B4] Length=493 Score = 40.0 bits (92), Expect = 0.13, Method: Compositional matrix adjust. Identities = 20/44 (46%), Positives = 25/44 (57%), Gaps = 0/44 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILR 45 G P P + RT +VLELA +L+ ENP RT + RILR Sbjct 74 GFEALVPEPRRLAARTDTQVLELAASLKRENPTRTVAQVARILR 117 >gi|111026943|ref|YP_708921.1| transposase [Rhodococcus jostii RHA1] gi|110825482|gb|ABH00763.1| probable transposase [Rhodococcus jostii RHA1] Length=490 Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 21/45 (47%), Positives = 24/45 (54%), Gaps = 0/45 (0%) Query 2 GSTPWCPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRA 46 G P T RT LELA +L+ ENP RT +QRILRA Sbjct 74 GFEELIPTTRAGTPRTDTATLELAASLKRENPARTVAQVQRILRA 118 >gi|258651521|ref|YP_003200677.1| Integrase catalytic subunit [Nakamurella multipartita DSM 44233] gi|258654632|ref|YP_003203788.1| Integrase catalytic subunit [Nakamurella multipartita DSM 44233] gi|258554746|gb|ACV77688.1| Integrase catalytic region [Nakamurella multipartita DSM 44233] gi|258557857|gb|ACV80799.1| Integrase catalytic region [Nakamurella multipartita DSM 44233] Length=493 Score = 37.4 bits (85), Expect = 0.69, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 0/40 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRA 46 CP+P + R V ELA L+ ENP RT + RILR+ Sbjct 79 CPSPREPGTRIDTGVFELAAGLKRENPARTVAQVARILRS 118 >gi|258653876|ref|YP_003203032.1| Integrase catalytic subunit [Nakamurella multipartita DSM 44233] gi|258557101|gb|ACV80043.1| Integrase catalytic region [Nakamurella multipartita DSM 44233] Length=495 Score = 37.4 bits (85), Expect = 0.70, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 0/40 (0%) Query 7 CPNPCQCTLRTPVEVLELAVALRPENPDRTAGAIQRILRA 46 CP+P + R V ELA L+ ENP RT + RILR+ Sbjct 79 CPSPREPGTRIDTGVFELAAGLKRENPARTVAQVARILRS 118 >gi|253687172|ref|YP_003016362.1| histidine kinase [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251753750|gb|ACT11826.1| histidine kinase [Pectobacterium carotovorum subsp. carotovorum PC1] Length=456 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 16/39 (42%), Positives = 25/39 (65%), Gaps = 0/39 (0%) Query 15 LRTPVEVLELAVALRPENPDRTAGAIQRILRAQLAGDRI 53 LR+P+ L+LA+ L +NPD ++QRI R L D++ Sbjct 249 LRSPLARLQLAIGLIRQNPDNVENSLQRIEREALLMDKM 287 Lambda K H 0.322 0.137 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 127366071138 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40