BLAST Search Results

BLASTP 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,229,318 sequences; 5,219,829,388 total letters Query= Rv3852 Length=134 Score E Sequences producing significant alignments: (Bits) Value gi|15610988|ref|NP_218369.1| histone-like protein HNS [Mycobacte... 248 3e-64 gi|253800903|ref|YP_003033905.1| histone-like protein hns [Mycob... 248 3e-64 gi|183985371|ref|YP_001853662.1| histone-like protein Hns [Mycob... 93.2 1e-17 gi|118620038|ref|YP_908370.1| histone-like protein Hns [Mycobact... 77.8 5e-13 gi|342860105|ref|ZP_08716757.1| hypothetical protein MCOL_14540 ... 64.3 5e-09 gi|15826912|ref|NP_301175.1| histone-like protein [Mycobacterium... 55.5 3e-06 gi|41406280|ref|NP_959116.1| hypothetical protein MAP0182c [Myco... 54.7 4e-06 gi|296166982|ref|ZP_06849396.1| histone family protein Hns [Myco... 47.8 5e-04 gi|321462389|gb|EFX73413.1| hypothetical protein DAPPUDRAFT_1098... 41.6 0.035 gi|227071966|gb|ACP19253.1| neurofilament triplet H1-like protei... 41.2 0.051 gi|225734511|gb|ACO25279.1| serine/threonine protein kinase [Epi... 40.8 0.062 gi|227071964|gb|ACP19252.1| neurofilament triplet H1-like protei... 37.0 0.91 gi|301606165|ref|XP_002932706.1| PREDICTED: hypothetical protein... 35.4 2.8 gi|166796751|gb|AAI59126.1| LOC779458 protein [Xenopus (Silurana... 35.0 3.5 gi|111308074|gb|AAI21353.1| LOC779458 protein [Xenopus (Silurana... 35.0 3.6 gi|205360894|ref|NP_001128553.1| antigen identified by monoclona... 35.0 4.2 gi|111307761|gb|AAI21193.1| Mki67 protein [Xenopus laevis] 34.3 7.2 gi|71679775|gb|AAI00169.1| LOC734164 protein [Xenopus laevis] 33.5 9.5 >gi|15610988|ref|NP_218369.1| histone-like protein HNS [Mycobacterium tuberculosis H37Rv] gi|15843483|ref|NP_338520.1| hypothetical protein MT3967 [Mycobacterium tuberculosis CDC1551] gi|31795026|ref|NP_857519.1| histone-like protein HNS [Mycobacterium bovis AF2122/97] 50 more sequence titles Length=134 Score = 248 bits (632), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%) Query 1 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA 60 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA Sbjct 1 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA 60 Query 61 EAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTL 120 EAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTL Sbjct 61 EAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTL 120 Query 121 SLLALLLIRQLRRR 134 SLLALLLIRQLRRR Sbjct 121 SLLALLLIRQLRRR 134 >gi|253800903|ref|YP_003033905.1| histone-like protein hns [Mycobacterium tuberculosis KZN 1435] gi|254366397|ref|ZP_04982441.1| histone-like protein hns [Mycobacterium tuberculosis str. Haarlem] gi|289556122|ref|ZP_06445332.1| histone-like protein hns [Mycobacterium tuberculosis KZN 605] 14 more sequence titles Length=141 Score = 248 bits (632), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%) Query 1 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA 60 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA Sbjct 8 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA 67 Query 61 EAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTL 120 EAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTL Sbjct 68 EAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTL 127 Query 121 SLLALLLIRQLRRR 134 SLLALLLIRQLRRR Sbjct 128 SLLALLLIRQLRRR 141 >gi|183985371|ref|YP_001853662.1| histone-like protein Hns [Mycobacterium marinum M] gi|183178697|gb|ACC43807.1| histone-like protein Hns [Mycobacterium marinum M] Length=156 Score = 93.2 bits (230), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 87/163 (54%), Positives = 96/163 (59%), Gaps = 36/163 (22%) Query 1 MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAP---- 56 M DPQDRPD EP PAKK PA KAAK TPAKK PAKKTPAK A + Sbjct 1 MADPQDRPDGEPDATPGQPAKKPPADKAAK------TPAKKTPAKKTPAKKAPAQKAPAK 54 Query 57 ---------------------PKPAEAPVSL----QQRIETNGQLAAAAKDAAAQAKSTV 91 P+PA P +L QQ+ NGQLA AAKDAAAQAKSTV Sbjct 55 KAPAKKAPAKKAPATKPPAQSPEPAPQPTALANVSQQQPSANGQLAEAAKDAAAQAKSTV 114 Query 92 EGANDALARNASVPAPSHSPVPLIVAVTLSLLALLLIRQLRRR 134 + AN+ L R A PSHS VPL+VA+ LSLLA+LLIRQLRRR Sbjct 115 DRANNPLPRVADE-QPSHSTVPLVVAIALSLLAMLLIRQLRRR 156 >gi|118620038|ref|YP_908370.1| histone-like protein Hns [Mycobacterium ulcerans Agy99] gi|118572148|gb|ABL06899.1| histone-like protein Hns [Mycobacterium ulcerans Agy99] Length=159 Score = 77.8 bits (190), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 89/161 (56%), Positives = 98/161 (61%), Gaps = 29/161 (18%) Query 1 MPDPQDRPDSEPSDASTPPAKKLPAKKAAK----KAPARKTPAKKAPAKKTPAKGAKSAP 56 M DPQDRPD EP PAKK PA KAAK K PA+KTPAKKAPA+K PAK A + Sbjct 1 MADPQDRPDGEPDATPGQPAKKPPADKAAKTPAKKTPAKKTPAKKAPAQKAPAKKAPAKK 60 Query 57 PKP-----------------------AEAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEG 93 A A VS QQ+ NGQLA AAKDAAAQAKSTV+ Sbjct 61 APAKKAPATKPPAQSPEPAEPAPQPTALANVS-QQQPSANGQLAEAAKDAAAQAKSTVDR 119 Query 94 ANDALARNASVPAPSHSPVPLIVAVTLSLLALLLIRQLRRR 134 AN+ L R A PSHS VPL+VA+ LSLLA+LLIRQLRRR Sbjct 120 ANNPLPRVAD-EQPSHSTVPLVVAIALSLLAMLLIRQLRRR 159 >gi|342860105|ref|ZP_08716757.1| hypothetical protein MCOL_14540 [Mycobacterium colombiense CECT 3035] gi|342132483|gb|EGT85712.1| hypothetical protein MCOL_14540 [Mycobacterium colombiense CECT 3035] Length=146 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 86/146 (59%), Positives = 99/146 (68%), Gaps = 12/146 (8%) Query 1 MPDPQDRPDSEPSDASTPPAKK------------LPAKKAAKKAPARKTPAKKAPAKKTP 48 M DPQD +S P A TPP K+ K AKKAPA+K PAKKAPAKK P Sbjct 1 MADPQDPTNSAPDGAGTPPEKRPPAKAAKKAAKAPAKKAPAKKAPAKKAPAKKAPAKKVP 60 Query 49 AKGAKSAPPKPAEAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPS 108 AK A+ PPKP E P+ +QQR E+NG L AAAKDAAAQAKSTVE AND ++ + A Sbjct 61 AKAAEPTPPKPPEQPLDVQQRAESNGDLTAAAKDAAAQAKSTVETANDPVSPAVAGAAAG 120 Query 109 HSPVPLIVAVTLSLLALLLIRQLRRR 134 SPVPLIVA+ +SLLA+LLIRQLRRR Sbjct 121 QSPVPLIVALAVSLLAILLIRQLRRR 146 >gi|15826912|ref|NP_301175.1| histone-like protein [Mycobacterium leprae TN] gi|221229390|ref|YP_002502806.1| histone-like protein [Mycobacterium leprae Br4923] gi|13092459|emb|CAC29575.1| histone-like protein [Mycobacterium leprae] gi|219932497|emb|CAR70160.1| histone-like protein [Mycobacterium leprae Br4923] Length=121 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 1/80 (1%) Query 55 APPKPAEAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPL 114 A P+ A + LQQRIETNGQL A KD A QA+S VEGA++ + A S+SPV L Sbjct 43 ASPQAANQSLGLQQRIETNGQLDVA-KDVAEQAQSAVEGASNPVPNGAEALEASNSPVAL 101 Query 115 IVAVTLSLLALLLIRQLRRR 134 ++A+ + LLALLLI QLRRR Sbjct 102 VIALAIGLLALLLIHQLRRR 121 >gi|41406280|ref|NP_959116.1| hypothetical protein MAP0182c [Mycobacterium avium subsp. paratuberculosis K-10] gi|118465552|ref|YP_879470.1| hypothetical protein MAV_0176 [Mycobacterium avium 104] gi|254773233|ref|ZP_05214749.1| hypothetical protein MaviaA2_00926 [Mycobacterium avium subsp. avium ATCC 25291] gi|41394628|gb|AAS02499.1| hypothetical protein MAP_0182c [Mycobacterium avium subsp. paratuberculosis K-10] gi|118166839|gb|ABK67736.1| conserved hypothetical protein [Mycobacterium avium 104] gi|336461865|gb|EGO40720.1| hypothetical protein MAPs_26130 [Mycobacterium avium subsp. paratuberculosis S397] Length=136 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 75/136 (56%), Positives = 84/136 (62%), Gaps = 2/136 (1%) Query 1 MPDPQDRPDSEPSDAS--TPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAKGAKSAPPK 58 M DPQD +S A A K KAPA+K PAKKAPAKK PAK A + Sbjct 1 MADPQDPTNSAADGAGDPPEKKPPAKAAKKTAKAPAKKAPAKKAPAKKAPAKKAPAKKAP 60 Query 59 PAEAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAV 118 P QR +TNG L AAAKDAAAQAKSTVE A++ +A PA SPVPLIVAV Sbjct 61 AKNTPTGGGQRADTNGDLTAAAKDAAAQAKSTVEAADNPVAPAVVGPAAGQSPVPLIVAV 120 Query 119 TLSLLALLLIRQLRRR 134 +SLLA+LLIRQLRRR Sbjct 121 AVSLLAILLIRQLRRR 136 >gi|296166982|ref|ZP_06849396.1| histone family protein Hns [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295897662|gb|EFG77254.1| histone family protein Hns [Mycobacterium parascrofulaceum ATCC BAA-614] Length=160 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%) Query 66 LQQRIETNGQLAAAAKDAAAQAKSTVEGANDALARNASVPAPSHSPVPLIVAVTLSLLAL 125 LQQRIE+NG LAAAAKD AAQAKSTV+ AN+ + A P SP+PL+VA+ +SLLA+ Sbjct 92 LQQRIESNGDLAAAAKDVAAQAKSTVDAANNPVPAGAPAAGPGQSPMPLLVALAVSLLAI 151 Query 126 LLIRQLRRR 134 LLIRQLRRR Sbjct 152 LLIRQLRRR 160 >gi|321462389|gb|EFX73413.1| hypothetical protein DAPPUDRAFT_109859 [Daphnia pulex] Length=363 Score = 41.6 bits (96), Expect = 0.035, Method: Compositional matrix adjust. Identities = 28/43 (66%), Positives = 31/43 (73%), Gaps = 1/43 (2%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAKGAKSAPPKPA 60 PAKK PAKK AK+ PA++TPAKK PAK TPAK S P K A Sbjct 249 PAKKTPAKKTQAKETPAKETPAKKTPAKDTPAKKTPSQPAKEA 291 Score = 40.0 bits (92), Expect = 0.10, Method: Compositional matrix adjust. Identities = 28/45 (63%), Positives = 33/45 (74%), Gaps = 3/45 (6%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAKG--AKSAPPKPA 60 PAK+ PAKK AKK A++TPAK+ PAKKTPAK AK P +PA Sbjct 244 PAKETPAKKTPAKKTQAKETPAKETPAKKTPAKDTPAKKTPSQPA 288 >gi|227071966|gb|ACP19253.1| neurofilament triplet H1-like protein [European sheatfish virus] Length=240 Score = 41.2 bits (95), Expect = 0.051, Method: Compositional matrix adjust. Identities = 27/70 (39%), Positives = 45/70 (65%), Gaps = 4/70 (5%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAKGAKSAP---PKPAEAPVSLQQRIETNG 74 PA+K PA+K+ A+K+PARK+PA+K+PA+K+P + + +P P P +PV + + + Sbjct 55 PARKSPARKSPARKSPARKSPARKSPARKSPVRSPRKSPVRVPSPVRSPVKEKTPVRSPA 114 Query 75 QLAAAAKDAA 84 + A D A Sbjct 115 RSEDAGSDFA 124 Score = 37.7 bits (86), Expect = 0.56, Method: Compositional matrix adjust. Identities = 20/33 (61%), Positives = 31/33 (94%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PA+K PA+K+ A+K+PARK+PA+K+PA+K+PA+ Sbjct 40 PARKSPARKSPARKSPARKSPARKSPARKSPAR 72 >gi|225734511|gb|ACO25279.1| serine/threonine protein kinase [Epizootic haematopoietic necrosis virus] Length=907 Score = 40.8 bits (94), Expect = 0.062, Method: Compositional matrix adjust. Identities = 25/47 (54%), Positives = 37/47 (79%), Gaps = 3/47 (6%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAKGAKSAPPKPAEAPV 64 PA+K PA+K+ A+K+PARK+PA+K+PA+K+PA+ KS P +PV Sbjct 212 PARKSPARKSPARKSPARKSPARKSPARKSPAR--KSPARSPVRSPV 256 Score = 40.4 bits (93), Expect = 0.088, Method: Compositional matrix adjust. Identities = 26/51 (51%), Positives = 41/51 (81%), Gaps = 5/51 (9%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAKG--AKSAPPK--PAEAPV 64 PA+K PA+K+ A+K+PARK+PA+K+PA+K+PA+ A+ +P + PA +PV Sbjct 202 PARKSPARKSPARKSPARKSPARKSPARKSPARKSPARKSPARKSPARSPV 252 Score = 37.0 bits (84), Expect = 0.86, Method: Compositional matrix adjust. Identities = 19/43 (45%), Positives = 30/43 (70%), Gaps = 0/43 (0%) Query 8 PDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAK 50 P S+ S + P + K A+K+PARK+PA+K+PA+K+PA+ Sbjct 182 PWSDWSSTGSSPFRSHMRKSPARKSPARKSPARKSPARKSPAR 224 >gi|227071964|gb|ACP19252.1| neurofilament triplet H1-like protein [European catfish virus] Length=275 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 20/33 (61%), Positives = 31/33 (94%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PA+K PA+K+ A+K+PARK+PA+K+PA+K+PA+ Sbjct 35 PARKSPARKSPARKSPARKSPARKSPARKSPAR 67 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 20/33 (61%), Positives = 31/33 (94%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PA+K PA+K+ A+K+PARK+PA+K+PA+K+PA+ Sbjct 45 PARKSPARKSPARKSPARKSPARKSPARKSPAR 77 >gi|301606165|ref|XP_002932706.1| PREDICTED: hypothetical protein LOC779458 [Xenopus (Silurana) tropicalis] Length=2134 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 26/47 (56%), Positives = 35/47 (75%), Gaps = 3/47 (6%) Query 19 PAKKLPAKKA--AKKAPARKTPAKKA-PAKKTPAKGAKSAPPKPAEA 62 P+K+ PAK A AKK+PA+++PAK A PAK++PAKGA A PA+ Sbjct 518 PSKRSPAKGASPAKKSPAKRSPAKGASPAKRSPAKGASPAKRSPAKG 564 >gi|166796751|gb|AAI59126.1| LOC779458 protein [Xenopus (Silurana) tropicalis] Length=1008 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 26/47 (56%), Positives = 35/47 (75%), Gaps = 3/47 (6%) Query 19 PAKKLPAKKA--AKKAPARKTPAKKA-PAKKTPAKGAKSAPPKPAEA 62 P+K+ PAK A AKK+PA+++PAK A PAK++PAKGA A PA+ Sbjct 488 PSKRSPAKGASPAKKSPAKRSPAKGASPAKRSPAKGASPAKRSPAKG 534 >gi|111308074|gb|AAI21353.1| LOC779458 protein [Xenopus (Silurana) tropicalis] Length=1006 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 26/47 (56%), Positives = 35/47 (75%), Gaps = 3/47 (6%) Query 19 PAKKLPAKKA--AKKAPARKTPAKKA-PAKKTPAKGAKSAPPKPAEA 62 P+K+ PAK A AKK+PA+++PAK A PAK++PAKGA A PA+ Sbjct 486 PSKRSPAKGASPAKKSPAKRSPAKGASPAKRSPAKGASPAKRSPAKG 532 >gi|205360894|ref|NP_001128553.1| antigen identified by monoclonal antibody Ki-67 [Xenopus laevis] gi|115527316|gb|AAI24561.1| Unknown (protein for MGC:132156) [Xenopus laevis] Length=2510 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 577 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 609 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 607 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 639 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 617 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 649 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 627 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 659 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 647 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 679 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 682 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 714 Score = 35.0 bits (79), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 692 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 724 >gi|111307761|gb|AAI21193.1| Mki67 protein [Xenopus laevis] Length=2080 Score = 34.3 bits (77), Expect = 7.2, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 1/35 (2%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAKGA 52 PAK PAK++ AK +PA+++PAK PAKK+PAKG+ Sbjct 616 PAKASPAKRSPAKASPAKRSPAKATPAKKSPAKGS 650 >gi|71679775|gb|AAI00169.1| LOC734164 protein [Xenopus laevis] Length=1109 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 577 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 609 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 607 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 639 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 617 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 649 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 627 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 659 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 647 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 679 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 682 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 714 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 1/33 (3%) Query 19 PAKKLPAKKA-AKKAPARKTPAKKAPAKKTPAK 50 PAK+ PAK AK++PA+ TPAK++PAK TPAK Sbjct 692 PAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAK 724 Lambda K H 0.306 0.121 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 129924441710 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Sep 5, 2011 4:36 AM Number of letters in database: 5,219,829,388 Number of sequences in database: 15,229,318 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40