Gene ML1070
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible TetR-family transcriptional regulatory protein |
| Comments | ML1070, len: 217 aa. Possible TetR-family transcriptional regulatory protein. Identical to the previously sequenced Mycobacterium leprae Q49962|U15180 (217 aa), Fasta scores: E(): 0, (100.0% identity in 217 aa overlap). Also similar to many transcriptional regulatory proteins and appears to be a paralogue of Rv3855|P96222|Z83864 ethR regulatory protein tetR family from M. tuberculosis (216 aa), Fasta scores: E(): 0, (60.4% identity in 202 aa overlap). Also similar to ML0064 ethR regulatory protein from M. leprae. Contains a probable helix-turn-helix motif at aa 49-70 (Score 1321, SD +3.69). Contains Pfam match to entry PF00440 tetR, Bacterial regulatory proteins, tetR family. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1234640 | 1235293 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1070|ML1070
MIVVGNFTQSNYVPASRGRRSSQLSGDDREQAILAVAERLLAERPLGDFSVDELAKGAGISRPTFYFYFPSKNAVLLSLLDDLNMKSRSAVEALAEQLPADPAAVWRSAITAFFEVCGTHRAVAVAGAAAKATSPEVRRLWSTVMQQWIDYNTAAIQAERKCGVAPDTIPAEDLAVALQLMTERVMAATFSDEKPLIPDKKVIDTLVHIWLASIYGS
Bibliography
No article yet recorded
