Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionProtein S12 is involved in the translation initiation step.
Product30S ribosomal protein S12 RpsL
CommentsRv0682, (MTV040.10), len: 124 aa. rpsL, 30S ribosomal protein S12 (see citations below), equivalent to others from Mycobacteria e.g. P41195|RS12_MYCSM 30S ribosomal protein S12 from Mycobacterium smegmatis (124 aa); P51999|RS12_MYCAV 30S ribosomal protein S12 from Mycobacterium avium (124 aa); etc. Also highly similar to others from other organisms e.g. P97222|RS12_STRCO 30S ribosomal protein S12 from Streptomyces roseosporus, lividans and coelicolor (123 aa); etc. Contains PS00055 Ribosomal protein S12 signature. Belongs to the S12P family of ribosomal proteins. Nucleotide position 781922 in the genome sequence has been corrected, A:G resulting in K121K.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS781560781934+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0682|rpsL
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG
      
Bibliography