Go to browser
virulence, detoxification, adaptation
lipid metabolism
conserved hypotheticals
pseudogenes
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
General annotation
TypeCDS
FunctionPlays an important role in several metabolic pathways [catalytic activity: D-glyceraldehyde 3-phosphate = glycerone phosphate]
ProductProbable triosephosphate isomerase Tpi (TIM)
CommentsRv1438, (MTCY493.16c), len: 261 aa. Probable tpi (tpiA), Triosephosphate isomerase, highly similar to many e.g. TPIS_MYCLE|P46711 Mycobacterium leprae (261 aa), FASTA scores: opt: 1456, E(): 0, (83.9% identity in 261 aa overlap). Contains PS00171 Triosephosphate isomerase active site. Belongs to the triosephosphate isomerase family. Rv1438, (MTCY493.16c), len: 261 aa. Probable tpi (tpiA), Triosephosphate isomerase, highly similar to many e.g. TPIS_MYCLE|P46711 Mycobacterium leprae (261 aa), FASTA scores: opt: 1456, E(): 0, (83.9% identity in 261 aa overlap). Contains PS00171 Triosephosphate isomerase active site. Belongs to the triosephosphate isomerase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 3_302 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16155641616349+
RBS16155551615559+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
      
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1438|tpi
VSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAGGPLP
      
Bibliography